KEGG   Panthera tigris altaica (Amur tiger): 102955741Help
Entry
102955741         CDS       T02988                                 

Gene name
TNFRSF13B
Definition
(RefSeq) TNF receptor superfamily member 13B
  KO
K05150  tumor necrosis factor receptor superfamily member 13B
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04672  Intestinal immune network for IgA production
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102955741 (TNFRSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102955741 (TNFRSF13B)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102955741 (TNFRSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102955741 (TNFRSF13B)
   04090 CD molecules [BR:ptg04090]
    102955741 (TNFRSF13B)
Cytokine receptors [BR:ptg04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102955741 (TNFRSF13B)
CD molecules [BR:ptg04090]
 Proteins
  102955741 (TNFRSF13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TACI-CRD2 BCMA-Tall_bind BaffR-Tall_bind
Motif
Other DBs
NCBI-GeneID: 102955741
NCBI-ProteinID: XP_007092359
LinkDB All DBs
Position
Un
AA seq 289 aa AA seqDB search
MSGLGRSRRGGRTRAGPEWSPQGLRMGVAMGQCPEEQYWDPLLNICLSCKLICSHQIPRT
CAAFCKSLSCHKEQGRYYDQLLRDCISCASICGRHPKQCTYFCENKFRSHANLPPELRRQ
RAGEAGTRPDDLGRYQGTEHRGSEPVPGLKLSADQLALVYSTLGLCLCAIICCFLLAVAC
FLKRRGDQFSCQPSPAPCQTQAKSSKDHWMEAGSAEGALPEPVETCSFCFPERRQPTQES
AGGPGTPGAARSGRWGRLGRTAIGQPCARAPQGGLEVLCAPAEEGGPTS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttgggccggagcaggcgaggtggccggacccgggcgggcccggagtggtct
ccacagggcctgcggatgggggtggccatgggtcagtgccccgaagaacagtactgggat
cccctactgaacatctgcctctcctgcaaactcatctgcagccatcagattccacgcacc
tgtgcagcattctgcaagtcactcagctgccacaaggagcaaggcaggtactacgaccag
ctcctgagggactgcatcagctgtgcctccatctgcggacgtcaccccaagcaatgcacg
tacttctgtgagaacaagttcaggagccacgcgaacctcccgccagagctcaggagacag
cgggctggggaagctggaaccaggccagacgacttgggaaggtaccagggaacggagcac
agaggctccgagccagttccagggctgaagctgagcgccgaccagctggccctggtctac
agcacactggggctctgcctctgtgccatcatctgctgcttcctcctggccgtggcctgc
ttcctcaagaggagaggggaccagttctcctgccagccctcaccggcaccgtgtcagacc
caggccaagtcctccaaggatcactggatggaagctggaagcgcggagggcgcgttgcca
gagccggtggagacgtgcagcttctgcttcccggagcgcaggcagcccacccaggagagc
gcgggcgggcccgggacccccggcgccgcgcgctctgggaggtgggggcgcctcggccgg
accgcgatcggacagccgtgcgcgcgcgccccgcaaggcggccttgaggtcctgtgcgct
cctgcggaggagggaggcccgacctcgtga

DBGET integrated database retrieval system