KEGG   Panthera tigris altaica (Amur tiger): 102955772
Entry
102955772         CDS       T02988                                 

Gene name
CHRNA7
Definition
(RefSeq) cholinergic receptor nicotinic alpha 7 subunit
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04020  Calcium signaling pathway
ptg04080  Neuroactive ligand-receptor interaction
ptg04725  Cholinergic synapse
ptg05010  Alzheimer disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05033  Nicotine addiction
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102955772 (CHRNA7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102955772 (CHRNA7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    102955772 (CHRNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102955772 (CHRNA7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102955772 (CHRNA7)
   05022 Pathways of neurodegeneration - multiple diseases
    102955772 (CHRNA7)
  09165 Substance dependence
   05033 Nicotine addiction
    102955772 (CHRNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ptg04040]
    102955772 (CHRNA7)
Ion channels [BR:ptg04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   102955772 (CHRNA7)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 102955772
NCBI-ProteinID: XP_015399173
LinkDB
Position
Un
AA seq 440 aa
MDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKTVRFPDGLIWKPDILLYNSADERF
DATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQM
QEADISGYIPNGEWDLVGIPGKRSEKFYECCKEPYPDVTFTVTIRRRTLYYGLNLLIPCV
LISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMI
IVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVGLACQHKPR
RCSLASVEMSAVAGPPTTNGNLLYIGFRGLDGVHCAPTPDSGVVCGRMACSPTHDEQLLH
GGQPPEGDPDLAKILEEVRYIANRFRCQDESEAICSEWKFAACVVDRLCLMAFSVFTIIC
TIGILMSAPNFVEAVSKDFA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggacgtggatgagaagaaccaagttctaactaccaacatttggctgcaaatgtcttgg
acagatcactatttacaatggaatatgtcagaatatccgggcgtgaagactgttcgtttc
ccagatggcctgatttggaagccagacattcttctctataacagtgctgatgagcgattt
gatgccacattccacaccaacgtgttagttaattcttctgggcattgccagtacctccct
ccaggcatattcaagagctcctgttacattgatgtgcgctggttcccctttgatgtgcag
cagtgcaaactcaagtttgggtcctggtcctatggagggtggtccttggatctacagatg
caagaggcagatatcagcggctatatcccaaatggagaatgggaccttgtgggaatccca
ggcaagcggagtgagaagttctatgagtgctgcaaagagccatacccagacgtcaccttc
acagtgaccattcgccgcaggaccctctactatggcctcaacctgctcatcccctgtgtg
ctcatctctgcgctggccctcctcgtcttcttgctccctgcagattctggggagaaaata
tctctggggataacagttttactctctcttactgtcttcatgttgctggtggctgagatc
atgcctgcgacatctgactcagtgcccttgatagcccagtactttgccagcaccatgatc
atcgtgggcctctctgtggtcgtgacagtgattgtgctgcagtatcaccaccacgacccc
gatggcggcaagatgcccaagtggaccagagtcatccttctgaactggtgcgcatggttc
ctgcgcatgaagaggcccggggaggacaaggtggggctggcctgccagcacaagccgcgc
cgctgcagcctggccagcgtggagatgagcgcggtggcagggccaccgaccaccaacggc
aacctgctctacatcggcttccgcggcctggacggtgtgcactgcgcccccacccccgac
tcgggcgtcgtgtgtggccgcatggcctgctcccccacgcacgacgagcagctcctacat
ggcgggcagccccccgagggggatcccgacctggccaagatcctggaggaggtccgctac
attgccaatcgcttccgctgccaggacgagagcgaggccatctgcagtgagtggaagttt
gccgcctgcgtggtggaccgcctgtgtctcatggccttctccgtcttcaccatcatctgc
accatcggcatcctgatgtccgccccaaacttcgtagaggctgtgtccaaagactttgct
taa

DBGET integrated database retrieval system