KEGG   Panthera tigris altaica (Amur tiger): 102955781
Entry
102955781         CDS       T02988                                 

Gene name
NAT1
Definition
(RefSeq) arylamine N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00232  Caffeine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102955781 (NAT1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102955781 (NAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102955781 (NAT1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     102955781 (NAT1)
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-GeneID: 102955781
NCBI-ProteinID: XP_007097063
LinkDB
Position
Un
AA seq 290 aa
MDIEAYFERIGYKNFRNKLDLETLTDILQHQIRAIPFENLNIHCGETMELGLKAIFEQVV
WRNRGGWCLQVNHLLYWVLTTIGYETTMLGGYVYSTAANKYSNAMIHLLLKVTTEGKNYI
VDAGFGRSYQMWQPLELISGKDQLQVPCIFRLTEERGIWYLDQIRRQQYIANEEFLNSDL
LEKNKYRKIYSFTLEPRTIEDFESVNTYLQTSPTSVFTSKSFCSLQTSEGVHCLVGCTLT
YRKFNYKDNMDLVEFKVLNEEEVEQKLKNTFNISLERKLVPKHGDQFFTI
NT seq 873 nt   +upstreamnt  +downstreamnt
atggacattgaagcatattttgaaagaattggttataagaattttaggaacaaattggac
ttggaaacattaactgacattcttcagcaccagatccgagccattccctttgagaacctt
aacatccattgtggggaaaccatggaattgggcttgaaggccatttttgagcaagttgtg
tggagaaaccgtggtggatggtgtctccaggtcaatcatcttctgtactgggttctgacc
acaattggttatgagaccacaatgttggggggttatgtgtacagtacagcagccaacaaa
tatagtaatgctatgattcatctcctgctgaaggtgactactgagggtaagaattacata
gtggatgctggatttggacgttcttaccagatgtggcagcctctggagttaatttctgga
aaggatcagcttcaagtgccttgcatcttccgcttgacagaagagagaggaatctggtac
ctggaccaaatcagaagacagcagtacattgcaaatgaagaatttcttaattctgatctc
ctggaaaaaaataaataccgaaaaatatactcctttactcttgaacctcgaacaattgaa
gattttgagtctgtgaatacataccttcagacatctccaacatctgtgtttacaagcaag
tcattctgttccttgcagacatctgaaggggttcactgtttagtgggctgcacccttacc
tataggaaattcaattataaggacaatatggatttggtagagtttaaggtcctgaatgaa
gaagaagtagaacaaaagctgaaaaatacatttaatatttccttagagagaaagcttgtg
cccaaacatggtgatcaattttttaccatttag

DBGET integrated database retrieval system