KEGG   Panthera tigris altaica (Amur tiger): 102955964
Entry
102955964         CDS       T02988                                 

Gene name
SRM
Definition
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00270  Cysteine and methionine metabolism
ptg00330  Arginine and proline metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Module
ptg_M00034  Methionine salvage pathway
ptg_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102955964 (SRM)
   00330 Arginine and proline metabolism
    102955964 (SRM)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102955964 (SRM)
Enzymes [BR:ptg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     102955964 (SRM)
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_31 Methyltransf_25 Methyltransf_12
Other DBs
NCBI-GeneID: 102955964
NCBI-ProteinID: XP_015391321
LinkDB
Position
Un
AA seq 332 aa
PAPPAGLPAQLRHVSSPVLPPGTPWQVGGDPSRPGRVGAHRPHCRGPRSLTVTPAFSKSY
GNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVLKHSSVES
VVQCEIDEDVIRVSKKFLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMG
PAESLFKESYYQLMKTALKDDGVLCCQGECQWLHLDLIKEMRQFCKSLFPVVAYAYCSIP
TYPSGQIGFFLWSSAQAPSGPSRDITGPLLSGRLLPQPILPDSRKLGDSEQDASPVPGLE
KVVLTSTSKRPGDVTVPLGLEHAWPGTSLFGT
NT seq 999 nt   +upstreamnt  +downstreamnt
cccgcccccccggcgggcctgcctgcccagcttcgccacgtgtcatccccagtacttccc
cctgggaccccttggcaggtcgggggagatccttctcgcccagggcgagtgggggcacat
cgcccccactgcaggggacccaggtccctaactgtcactcctgccttcagtaagagctac
ggcaacgttctggtgttggacggcgtcatccagtgcacagagagggacgagttctcctac
caggagatgatagccaacctgcccctctgcagccaccccaacccacgcaaggtgctgatc
atcgggggtggggacgggggtgtcctgcgggaggtgttgaagcactcctccgtggagtcc
gtggtccagtgtgagattgatgaggacgtcattcgggtctctaagaagttcctgccgggc
atggccgtgggctactccagttccaagttgaccctacacgtgggtgacggttttgagttc
atgaaacagaaccaggatgccttcgatgtcatcatcactgactcctcagaccccatgggc
cctgcggagagtctcttcaaggaatcctattaccagctcatgaaaacggctctcaaggat
gatggcgtcctctgctgccagggtgagtgccagtggctgcacctggacctcatcaaggag
atgcgacagttctgcaagtcgctcttccctgtggtggcctacgcttactgcagtatcccc
acctaccccagcggccagataggcttctttctgtggagctcagcccaagcaccctcgggc
cccagcagggacatcaccgggcctctgctctcagggcgcctcctgccccagcccatctta
ccagactccaggaagctgggtgactcggagcaggacgcttcacctgtccctggtttggag
aaggtggtgctgacctctacctccaagcgtcccggggacgttacggtgcccctgggccta
gaacatgcttggccgggcaccagcctctttgggacatga

DBGET integrated database retrieval system