KEGG   Panthera tigris altaica (Amur tiger): 102956027
Entry
102956027         CDS       T02988                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04140  Autophagy - animal
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04370  VEGF signaling pathway
ptg04510  Focal adhesion
ptg04722  Neurotrophin signaling pathway
ptg04910  Insulin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05165  Human papillomavirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05223  Non-small cell lung cancer
ptg05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102956027 (BAD)
   04014 Ras signaling pathway
    102956027 (BAD)
   04370 VEGF signaling pathway
    102956027 (BAD)
   04024 cAMP signaling pathway
    102956027 (BAD)
   04022 cGMP-PKG signaling pathway
    102956027 (BAD)
   04151 PI3K-Akt signaling pathway
    102956027 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102956027 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    102956027 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102956027 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102956027 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102956027 (BAD)
   04919 Thyroid hormone signaling pathway
    102956027 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102956027 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102956027 (BAD)
   05203 Viral carcinogenesis
    102956027 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102956027 (BAD)
   05212 Pancreatic cancer
    102956027 (BAD)
   05225 Hepatocellular carcinoma
    102956027 (BAD)
   05221 Acute myeloid leukemia
    102956027 (BAD)
   05220 Chronic myeloid leukemia
    102956027 (BAD)
   05218 Melanoma
    102956027 (BAD)
   05211 Renal cell carcinoma
    102956027 (BAD)
   05215 Prostate cancer
    102956027 (BAD)
   05213 Endometrial cancer
    102956027 (BAD)
   05223 Non-small cell lung cancer
    102956027 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102956027 (BAD)
   05014 Amyotrophic lateral sclerosis
    102956027 (BAD)
   05020 Prion disease
    102956027 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    102956027 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102956027 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102956027 (BAD)
   05161 Hepatitis B
    102956027 (BAD)
   05160 Hepatitis C
    102956027 (BAD)
   05162 Measles
    102956027 (BAD)
   05168 Herpes simplex virus 1 infection
    102956027 (BAD)
   05165 Human papillomavirus infection
    102956027 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102956027 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102956027 (BAD)
   01524 Platinum drug resistance
    102956027 (BAD)
   01522 Endocrine resistance
    102956027 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 102956027
NCBI-ProteinID: XP_007091969
LinkDB
Position
Un
AA seq 168 aa
MFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTAPGLLGEAGHQQGQPASSNH
HGGAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSD
EFQGSFKGLPRPKSAGTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcccagtgagcaggaagactccagccctacggatagg
ggcctgggccccagccccacaggggaccggccccgcggccctggcaagcaccagcggacg
gccccaggcctcctcggggaagctggtcaccagcaggggcagcccgccagcagcaaccac
catggaggcgctggggctgtggagacccggagtcgccacagctcgtaccccgccgggacc
gaggaggatgaagggacggaggaggaagagcccagccctttccggggtcgctcgcgctca
gcgccccccaacctctgggccgccctgcgctacggccgcgagctccggaggatgagcgac
gagttccagggctccttcaagggacttccacgcccgaagagcgcgggcacagcgacgcag
atgcggcaaagccccagctggacgcgcttcatccagtcctggtgggatcggaacttgggg
agaggaggctccgccccctcccagtga

DBGET integrated database retrieval system