KEGG   Panthera tigris altaica (Amur tiger): 102956075
Entry
102956075         CDS       T02988                                 

Gene name
KYAT1, CCBL1
Definition
(RefSeq) kynurenine aminotransferase 1
  KO
K00816  kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase [EC:2.6.1.7 4.4.1.13 2.6.1.64]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00270  Cysteine and methionine metabolism
ptg00380  Tryptophan metabolism
ptg00450  Selenocompound metabolism
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102956075 (KYAT1)
   00380 Tryptophan metabolism
    102956075 (KYAT1)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102956075 (KYAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102956075 (KYAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ptg01007]
    102956075 (KYAT1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     102956075 (KYAT1)
    2.6.1.64  glutamine---phenylpyruvate transaminase
     102956075 (KYAT1)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     102956075 (KYAT1)
Amino acid related enzymes [BR:ptg01007]
 Aminotransferase (transaminase)
  Class I
   102956075 (KYAT1)
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_3
Other DBs
NCBI-GeneID: 102956075
NCBI-ProteinID: XP_007078919
LinkDB
Position
Un
AA seq 460 aa
MFRNAAAISLQLMGPLQRKKAGTSVTRCLHQTLTMAKRVQARRLDGIDHNPWVEFVKMAS
ECDAVNLGQGFPDFPPPDFAVEAFQHALSSDFMLNQYTRAFGYPPLTKILASFFGKLLGQ
EIDPFKNVLVTVGAYGALFTAFQALVEEGDEVIIIEPFFDCYEPMTLMAGGHPVFVTLKP
GLTRDGELDSSSNWQLDPTELASKFTSHTKALILNTPNNPVGKVFSKAELELVASLCQQH
DVICISDEVYQWLVYDGYQHVSIGEPSRPGCPRFPLDFRGRAPEPNPEVSARPASKPLRT
VPESSISHCPTQGQAAVAQSFEHEQLHFGQASSYFARFPQAMQRTRDHMIRSLQSVGLKP
VVSQGSYFFMADISDXSVWLLSPESKMPDLPGDVDEPYDRRFVKWMIKTKGLVAIPVSTF
YSVPHRKIFDHYIRFCFVKDESTLQAMDEKLQKWKKELRP
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgttcaggaatgcggcagccatctctttacagctgatggggcccctccagagaaagaag
gctggaacttctgtcactcggtgcttgcaccagactctcaccatggccaagagggtgcaa
gctcgcaggctggacgggattgaccacaacccatgggtggagtttgtgaaaatggccagt
gaatgcgatgctgtgaacttgggccaaggcttccccgacttcccacccccagatttcgct
gtggaagcctttcagcacgccctcagcagcgacttcatgctgaaccagtacaccagggca
tttggttacccacccctgacaaagatcctggcaagtttctttgggaagctgctgggacag
gagatagacccgttcaagaacgtgctggtgactgtgggtgcctatggggccctgttcaca
gccttccaggccctggtggaagaaggagacgaggtcatcatcatcgagcccttttttgac
tgttatgaacccatgacgttgatggcggggggtcatcctgtgtttgtgaccttgaagccg
ggcctcactcgggatggggaactggattccagcagcaactggcagctggaccccacagag
ctggccagcaagtttacctctcataccaaagccctaattctcaacacacccaacaaccct
gtgggaaaggtgttctccaaggcggaactggagctagtggccagcctgtgccagcagcat
gacgtgatatgcatctctgacgaggtctaccagtggctggtctacgacgggtaccagcat
gtcagcatcggtgagccaagccgacctgggtgcccgcgtttccccctggactttcgtggc
cgggccccggagcccaacccggaagtcagtgccaggccggccagtaaacccctgcgcacg
gtgcccgagagctctatctcccactgtcccacgcagggtcaggcggcagtggcccagagc
ttcgagcacgagcagcttcactttggccaagccagcagctactttgcgcggttcccgcag
gccatgcagcgcacccgtgaccacatgatacgcagcctgcagtctgtgggcttgaagccc
gtggtctcccagggcagctacttcttcatggcagacatctcagactngtcagtgtggctt
ctgtcccccgagagcaagatgcccgacttgcctggtgacgtggatgagccctacgacaga
cgcttcgtcaagtggatgatcaaaaccaagggcttggtggccatcccggtctccaccttc
tacagcgtgcctcatcggaagatctttgaccactatatccgcttctgtttcgtgaaggat
gagtccacactccaggccatggatgagaagctgcagaaatggaagaaggagctcaggccc
tga

KEGG   Panthera tigris altaica (Amur tiger): 102960707
Entry
102960707         CDS       T02988                                 

Gene name
KYAT3, CCBL2
Definition
(RefSeq) kynurenine aminotransferase 3
  KO
K00816  kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase [EC:2.6.1.7 4.4.1.13 2.6.1.64]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00270  Cysteine and methionine metabolism
ptg00380  Tryptophan metabolism
ptg00450  Selenocompound metabolism
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102960707 (KYAT3)
   00380 Tryptophan metabolism
    102960707 (KYAT3)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102960707 (KYAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102960707 (KYAT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ptg01007]
    102960707 (KYAT3)
Enzymes [BR:ptg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     102960707 (KYAT3)
    2.6.1.64  glutamine---phenylpyruvate transaminase
     102960707 (KYAT3)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     102960707 (KYAT3)
Amino acid related enzymes [BR:ptg01007]
 Aminotransferase (transaminase)
  Class I
   102960707 (KYAT3)
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Other DBs
NCBI-GeneID: 102960707
NCBI-ProteinID: XP_007079217
LinkDB
Position
Un
AA seq 455 aa
MFLAQRRLCSLESRAKFLKTIYSSKILGLPTSAKMSLKITSAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGLPDISPPIYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSCLYEKIYQK
QINPNKEILVTVGAYGSLFNTIQGLIDEGDEVIVIVPFYDCYEPMVRMAGATPVFIPLRP
KPVDGKKWSSSDWTLDPQELASKFNSKTKAIILNTPHNPIGKVYTKEELQVIADLCIKYD
TLCISDEVYEWLVYTGNKHVKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTVYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMIHLLESL
GLKPIVPDGGYFIIADVSLLDADLSDMKDSNEPYDYKFVKWMTKNKKLSAIPVSAFCNAE
TKLQFEKFVRFCFIKKDSTLDAAEEIIKGWNRQKS
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtttttggcccagaggagactttgctcccttgaaagtagagcaaaattcctgaagaca
atttattcttcaaaaatccttggacttcctacttctgctaaaatgtctttgaaaatcacc
agtgcaaaacgaattgaaggccttgatagtaatgtgtggattgaatttaccaagttggcc
gcagacccctctgttgtgaatcttggccaaggccttccagatatatcccctcctatatat
gtaaaggaagaattatcaaagattgcagcaatcgatagcctgaaccagtatacacgaggc
tttggtcatccatcgcttgtgaaagctctatcctgcttatatgaaaaaatttatcaaaag
caaatcaatccaaataaagaaatccttgtgacagtaggagcatatggatctctttttaat
accattcaaggattaattgatgagggagatgaagtcatagtaatagtacctttctatgac
tgctatgagcccatggtgagaatggctggagcaacacctgtttttattcccctaagacct
aaacctgtcgatgggaaaaaatggtctagttctgactggacattggatcctcaagaactg
gcaagtaagtttaactccaaaaccaaagcgattatactgaatactccacataaccccatt
ggcaaggtatataccaaagaagaactccaagtaattgctgacctttgcatcaaatatgac
acactctgcatcagtgatgaggtttatgaatggcttgtatatactggaaataaacatgta
aaaatagctacttttccaggtatgtgggagagaacaataacgataggaagtgccggaaag
actttcagtgtaactggctggaagcttggctggtccattggtcctaatcatttgataaaa
catttacagacagttcaacaaaacactgtttatacttgtgctacacctttacaggaagcc
ttggctcaagctttttggattgacatcaagcgcatggatgacccagagtgttactttaat
tctttgccaaaagagttagaagtaaaaagagatcggatgatacatttacttgaaagtctt
ggcctaaaacccatagttcctgatgggggatacttcatcattgctgatgtgtctttgcta
gatgcagacctctctgatatgaaggacagcaatgaaccttatgactataaatttgtgaaa
tggatgactaaaaataagaaactgtcagccattccagtttccgcattctgtaacgcagag
accaaattacagtttgagaagtttgtgcgattttgcttcattaaaaaagacagtacactg
gatgctgctgaagaaatcattaagggatggaatagacagaagtcttga

DBGET integrated database retrieval system