KEGG   Panthera tigris altaica (Amur tiger): 102956127
Entry
102956127         CDS       T02988                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04210  Apoptosis
ptg04380  Osteoclast differentiation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04623  Cytosolic DNA-sensing pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04668  TNF signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04926  Relaxin signaling pathway
ptg04931  Insulin resistance
ptg05132  Salmonella infection
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05215  Prostate cancer
ptg05220  Chronic myeloid leukemia
ptg05222  Small cell lung cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102956127 (NFKBIA)
   04668 TNF signaling pathway
    102956127 (NFKBIA)
   04024 cAMP signaling pathway
    102956127 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102956127 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102956127 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    102956127 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    102956127 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    102956127 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    102956127 (NFKBIA)
   04660 T cell receptor signaling pathway
    102956127 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    102956127 (NFKBIA)
   04659 Th17 cell differentiation
    102956127 (NFKBIA)
   04657 IL-17 signaling pathway
    102956127 (NFKBIA)
   04662 B cell receptor signaling pathway
    102956127 (NFKBIA)
   04062 Chemokine signaling pathway
    102956127 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102956127 (NFKBIA)
   04926 Relaxin signaling pathway
    102956127 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102956127 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102956127 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102956127 (NFKBIA)
   05203 Viral carcinogenesis
    102956127 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102956127 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102956127 (NFKBIA)
   05215 Prostate cancer
    102956127 (NFKBIA)
   05222 Small cell lung cancer
    102956127 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102956127 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102956127 (NFKBIA)
   05135 Yersinia infection
    102956127 (NFKBIA)
   05134 Legionellosis
    102956127 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102956127 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    102956127 (NFKBIA)
   05161 Hepatitis B
    102956127 (NFKBIA)
   05160 Hepatitis C
    102956127 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    102956127 (NFKBIA)
   05164 Influenza A
    102956127 (NFKBIA)
   05162 Measles
    102956127 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    102956127 (NFKBIA)
   05163 Human cytomegalovirus infection
    102956127 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102956127 (NFKBIA)
   05169 Epstein-Barr virus infection
    102956127 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102956127 (NFKBIA)
   05140 Leishmaniasis
    102956127 (NFKBIA)
   05142 Chagas disease
    102956127 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102956127 (NFKBIA)
   04131 Membrane trafficking [BR:ptg04131]
    102956127 (NFKBIA)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    102956127 (NFKBIA)
Membrane trafficking [BR:ptg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102956127 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 102956127
NCBI-ProteinID: XP_007073791
LinkDB
Position
Un
AA seq 253 aa
MHSAALGVFPSLTLRFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVIT
NQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATNY
NGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCGA
DVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELP
YDDCVLGGQRLTL
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcactcagcggccctgggggtttttccctctcttacccttaggttcctgcacttggcc
atcatccatgaagagaaggcattgaccatggaagtggtccgccaagtgaaaggagacctg
gccttcctcaatttccagaacaacctgcagcagactccactccacttggctgtgatcacc
aaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccgagac
tttcgaggaaatacccccctacacctcgcctgtgagcaaggctgcctggccagtgtggga
gtcctgactcagacctgcaggacccagcacctctactccatcctgcaggccaccaactac
aatggtcacacatgtctacacttagcctctatccatggctacctgggcatcgtggagctt
ttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgccctc
catcttgcagtggacctgcagaattccgacctcgtgtcgcttttgttgaagtgtggggct
gatgtcaacagagtcacctaccaaggctactccccgtaccagctcacttggggccgccca
agtacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctgcca
gagagcgaggatgaggagagctacgacacggagtcagagttcacagaggacgagctgccc
tatgatgactgtgtgcttggaggccaacgcctgacgttatga

DBGET integrated database retrieval system