KEGG   Panthera tigris altaica (Amur tiger): 102956226Help
Entry
102956226         CDS       T02988                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04146  Peroxisome
ptg04213  Longevity regulating pathway - multiple species
ptg05014  Amyotrophic lateral sclerosis (ALS)
ptg05016  Huntington disease
ptg05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102956226 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102956226 (SOD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    102956226 (SOD1)
   05016 Huntington disease
    102956226 (SOD1)
   05020 Prion diseases
    102956226 (SOD1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102956226 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102956226
NCBI-ProteinID: XP_015397544
LinkDB All DBs
Position
Un
AA seq 131 aa AA seqDB search
LKGNGPVVVSGTIRGLTEGEHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVG
DLGNVTAGKDGVANVSMEDSLIALSGDHSIIGRTMVVHEKRDDLGKGGNEESTQTGNAGS
RLACGVIGIAK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
ctaaagggcaatgggcctgttgtggtatcaggaaccattagaggattgactgaaggcgag
catggattccacgtccatcagtttggagataatacacaaggctgtaccagtgcaggccct
cactttaatcctctatccaaaaaacacggtgggccaaaagatgaagagaggcatgttgga
gaccttggcaacgtaactgctggcaaggacggtgtggccaacgtgtctatggaagattct
ctgattgcactctcaggagaccattccatcattggccgcacgatggtggtccacgagaaa
cgagatgacttgggcaaaggtggaaatgaagaaagtacgcaaacgggaaacgctgggagt
cgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system