KEGG   Panthera tigris altaica (Amur tiger): 102956310Help
Entry
102956310         CDS       T02988                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00052  Galactose metabolism
ptg00500  Starch and sucrose metabolism
ptg01100  Metabolic pathways
ptg04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102956310 (GAA)
   00500 Starch and sucrose metabolism
    102956310 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102956310 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102956310 (GAA)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102956310 (GAA)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102956310 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102956310
NCBI-ProteinID: XP_015397222
LinkDB All DBs
Position
Un
AA seq 921 aa AA seqDB search
MDARWPLCCRPLLGAYILVSLATAALLGHVLLHDFLLVPQEQRGFSQVAEGLYRARQQGA
GHPGPQAPPGHHGSPRAAPTRCDVPPNSRFDCAPDKAITQEQCEARGCCYVPAGQWPRVP
RMGQPWCFFPPSYPSYKLHNLTTTETGYTATLTRATPTFFPKDILTLRLDVLLETESRLH
FTIKDPANRRYEVPLETPRVRSRASSTLYSVDLQEEPFGVVVRRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQHITGLAEHLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLL
LEDGGLAHGXXXXXXXGGDVVLQPSPALSWRSTGGILDMYIFLGPEPKSVVRQYLEVVGR
LVPQPCAAPSSPPPLLCRWGSPSTAVTRQVVENMTRADFPLDTQWNDLDYMDARRDFTFN
KDGFGDFPAMVQELHRSGRHYVMIIDPAISSSSPPGSYRPYDEGLRRKVFITNDTGQPLI
GKVWPGLTAFPDFTSPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDSD
LENPPYVPGELPPPASPHPPAPWPQLPEAQIRAFASLVWETQSCPPQRQKARGRGFNRGK
QRQRSRGQKQRTSARAPLWDRGGRSHKMPIFSRKEKKKKKVCRKGQQGTGLLTPLTAPLP
PPAKLGRREPAPRASAXXPLEHADLRGHQAHEPTPPVRRFPEDPRTWAVDRQLLWGAALL
ITPVLEAGKVEVTGYFPAGTWYDLQTVPAEALGSLPPPPPAPVTPAIHSRGQWVTLLAPL
DTINLHLRAGHIIPLQGLGLTTTESRKQPMALVAALTTNGEARGELFWDDGESLETFERG
AYTQVVFLAKNNTVVNELVHVTSEGASLQLRKATVLGVATAPKQVLSNGVPVSNFTYSPD
TKTLDIPVSLTMGEQFVISWS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaggtggccgctgtgctgccgccccctgctgggggcctacatcctcgtgtcc
ctggccaccgccgccctcctggggcacgtcctgctccatgatttcttgctggtcccccaa
gagcagcgtggcttctcccaagtagctgaggggctttatcgagctcgccagcagggagcc
ggccacccaggcccccaggcccccccaggccaccacggcagtcccagagcagctcccacg
cggtgcgacgtgccccccaacagccgcttcgactgcgccccagacaaggccatcacccag
gagcagtgtgaggcccggggctgctgctacgtgcctgccgggcagtggcctcgggtcccc
cgcatgggacagccctggtgcttcttcccacccagctacccgagttacaagctgcacaac
ctgaccaccacggagacaggctacacggccaccctgacccgcgccaccccaaccttcttc
cccaaggacatcttgaccttacgcctggacgtgctgctggagactgagagtcgactccac
ttcacgatcaaagatcccgccaacaggcgctacgaggtgcccttggagaccccgcgtgtc
cgcagccgggcctcatccacactttacagcgtggacctccaggaggagcccttcggggtg
gtcgtgcgccggaagctggacggccgggtgctgctgaacacgacggtggcccccctgttc
tttgctgaccagtttctgcagctgtctacctctctgccgtcccagcacatcacgggcctg
gccgagcatctcggctccctgatgcttagcaccaactggaccaagatcaccctgtggaac
cgggacatcgcccccgagcccaacgtgaacctgtacgggtcccaccccttctacctcctg
ctggaggatggcggcctggctcacggnnnnnnnnnnnnnnnnnnnnnggggggggatgtg
gtcctgcagccgagcccggccctcagctggcggtccacgggtgggatcctggacatgtac
atcttcctgggccctgagcccaagagcgtggtgcggcagtacctggaagtcgtgggtagg
ctggtcccccagccctgcgctgccccctcgtctcccccacccctcctttgccgctggggc
tccccctccacggccgtcacccgccaggtggtggagaacatgaccagggccgacttcccc
ctggacactcagtggaatgacctggattacatggacgcgaggagagacttcactttcaac
aaggacggcttcggggacttcccagccatggtgcaggagctccaccggagtggccggcac
tatgtgatgatcatagatcctgccatcagcagctccagccctcctggcagctaccgacct
tatgacgagggtctgcggaggaaggttttcatcaccaatgacactgggcagccactgatc
gggaaggtgtggcccggattgaccgccttccccgacttcaccagccccgaggcccttgac
tggtggcaggacatggtggctgagttccacgcccaggtgcctttcgacggcatgtggatc
gatatgaacgagccatccaacttcgtcaagggctctgtggacggctgccccgacagtgac
ctggagaacccgccctacgtgccaggcgagcttccccctcctgccagccctcacccgccg
gccccctggccccagctgcccgaggctcagatcagggcttttgcttctctggtttgggag
actcagagctgtcctcctcaaaggcaaaaggcaagggggagagggtttaacagagggaaa
cagaggcaacgctcccgtggacagaaacagagaacgtcagcacgtgccccgctgtgggat
cgcggaggcaggtcacacaagatgccaatcttctcacgtaaagaaaagaaaaaaaaaaaa
gtttgccggaaaggccagcaggggacagggttactcactcccctcaccgcccccctccca
ccccctgccaagctcgggcggcgggaaccagctccccgggcttccgcgnnnnnncccctt
gagcacgccgacctcagaggtcaccaggcccacgagcccacccctcccgtgcgaaggttc
cccgaggacccccgcacctgggccgtggaccgccagctcctgtggggagcagctctgctc
atcaccccggtgctcgaggccgggaaggttgaagtgaccggttacttccccgctggcaca
tggtacgacctgcagacggtgccagcagaggccctcggcagcctcccgcctccacctccc
gcacctgtcacgcctgccatccacagcaggggacagtgggtgacactgctggccccactg
gacaccatcaatctccacctccgggccgggcacatcatccccctgcagggccttggcctc
acaaccacggagtcccgaaagcagcccatggccctggtcgcagccctgaccacgaacggg
gaggcccgaggagagctgttctgggacgacggggagagcctggagacgttcgagcgtggg
gcctacacacaggtcgtcttccttgccaagaataacaccgttgtgaatgagctggtgcac
gtgaccagtgagggggccagcctgcaactgaggaaggccaccgtcctgggggtggccaca
gcccccaagcaggtcctctccaatggcgttcctgtctccaacttcacctacagccctgac
acgaagaccctggacatccctgtctcactgacgatgggagaacagtttgtcatcagctgg
tcttaa

DBGET integrated database retrieval system