KEGG   Panthera tigris altaica (Amur tiger): 102956322
Entry
102956322         CDS       T02988                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04024  cAMP signaling pathway
ptg04260  Cardiac muscle contraction
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04270  Vascular smooth muscle contraction
ptg04713  Circadian entrainment
ptg04720  Long-term potentiation
ptg04723  Retrograde endocannabinoid signaling
ptg04724  Glutamatergic synapse
ptg04725  Cholinergic synapse
ptg04726  Serotonergic synapse
ptg04727  GABAergic synapse
ptg04728  Dopaminergic synapse
ptg04742  Taste transduction
ptg04911  Insulin secretion
ptg04912  GnRH signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04924  Renin secretion
ptg04925  Aldosterone synthesis and secretion
ptg04927  Cortisol synthesis and secretion
ptg04929  GnRH secretion
ptg04930  Type II diabetes mellitus
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg05010  Alzheimer disease
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05031  Amphetamine addiction
ptg05410  Hypertrophic cardiomyopathy
ptg05412  Arrhythmogenic right ventricular cardiomyopathy
ptg05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102956322 (CACNA1C)
   04020 Calcium signaling pathway
    102956322 (CACNA1C)
   04024 cAMP signaling pathway
    102956322 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    102956322 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102956322 (CACNA1C)
   04929 GnRH secretion
    102956322 (CACNA1C)
   04912 GnRH signaling pathway
    102956322 (CACNA1C)
   04921 Oxytocin signaling pathway
    102956322 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    102956322 (CACNA1C)
   04924 Renin secretion
    102956322 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    102956322 (CACNA1C)
   04927 Cortisol synthesis and secretion
    102956322 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102956322 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102956322 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102956322 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    102956322 (CACNA1C)
   04727 GABAergic synapse
    102956322 (CACNA1C)
   04725 Cholinergic synapse
    102956322 (CACNA1C)
   04728 Dopaminergic synapse
    102956322 (CACNA1C)
   04726 Serotonergic synapse
    102956322 (CACNA1C)
   04720 Long-term potentiation
    102956322 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    102956322 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    102956322 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102956322 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102956322 (CACNA1C)
   05020 Prion disease
    102956322 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    102956322 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    102956322 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102956322 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102956322 (CACNA1C)
   05414 Dilated cardiomyopathy
    102956322 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102956322 (CACNA1C)
   04934 Cushing syndrome
    102956322 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ptg04040]
    102956322 (CACNA1C)
Ion channels [BR:ptg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102956322 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102956322
NCBI-ProteinID: XP_015397790
LinkDB
Position
Un
AA seq 2186 aa
MVNENTRMYIPEENHQGSNYGSPRAAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTISSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEIMEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNP
ENTGEDDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVF
TSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVL
RVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSD
SSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPEL
LYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNC
ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQH
YGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVIL
SETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTE
INRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFA
VFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRI
KTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK
KRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASE
DDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGNSQGDTESPSHEKLVDST
FTPSSYSSTGSNANINNANNTALGRFPRPAGYPSAVSTVEGHGPPLSPAVRVQEAAWKLS
SKRCHSRESQIAMVCQEEVSQDETYDVKISEDTEYCSEPSLISTEMLSYQDDENRQLTPP
EEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAV
AGLSPLLQRSHSPSTSPRPCATPPATPGSRGWPPQPIPTLRLEGAESSEKLNSSFPSIHC
SSWSGEPTPCGGGGSTIRRARPVSLTVPGQAGAQGRQFHGSASSLVEAVLISEGLGQFAQ
DPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAEGQ
EGETCAPTLTCRKTRTAEPTSAACSS
NT seq 6561 nt   +upstreamnt  +downstreamnt
atggtcaatgagaacacgaggatgtacattccagaggaaaaccaccaaggttccaactat
gggagcccgcgcgcagctcacgccaacatgaatgccaatgcggctgcggggctcgccccc
gagcacatcccaacgcccggggcagccttgtcctggcaggcagccatcgacgcagcccgg
caggctaagctgatgggcagcgctggcaatgcaaccatctccaccatcagctccacacag
cggaagcggcagcaatatgggaaacccaagaagcagggcagcacgaccgccacacgcccg
ccccgcgccctgctctgcctgactctgaagaaccccatcaggagggcgtgcatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattccctttccagaagacgactccaatgccaccaattccaacctggaa
cgagtggaatatctctttctcataatttttactgtggaagcatttttaaaagtaatagcc
tatggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggttgtagggctttttagtgcaattttagaacaagccaccaaagccgacggg
gcaaatgctctaggagggaaaggagctggatttgatgtgaaggcactgagggcattccgc
gtgctgcgccccttgcggctggtgtctggagtcccaagtctccaagtcgttctgaattcc
attatcaaggccatggtccccctgctgcatattgccctgttagtgctatttgtcatcatc
atctacgctatcattggcctggagctcttcatgggaaagatgcataagacctgctacaac
caggagggcatagcagatgttccagcagaagatgatccttccccttgtgctctggagact
ggccatgggcggcagtgccagaatggcactgtgtgcaagcctggctgggacgggcccaag
cacggcatcaccaactttgacaattttgccttcgccatgttgacagtgttccagtgcatc
accatggagggctggacagatgtgctatactgggtcaatgatgccgtaggaagggactgg
ccctggatctattttgttacacttatcatcatagggtcattttttgtacttaacttggtt
ctcggtgttcttagcggagagttttccaaagagagagagaaggccaaggctcggggagac
ttccagaagctgcgagagaagcagcagctggaagaggacctgaagggctacctggactgg
atcacccaggcagaggacatcgaccctgagaacgaggacgaaggcatggatgaggagaag
ccccgaaacatgagcatgcccacaagtgagaccgagtctgtcaacaccgaaaacgtggct
ggaggtgacatcgagggagagaactgcggggccaggctggcccatcggatttccaaatca
aagttcagccgctactggcgtcggtggaatcggttctgcagaagaaagtgtcgtgctgca
gtcaagtctaatgtcttctactggcttgtgatcttcctggtgttcctcaacacactcacc
atcgcctcagaacattacaaccagccccactggctcacggaggtccaagacacggccaac
aaggcactactggcccttttcactgcggagatgctgctaaagatgtacagcctgggcctg
caggcctactttgtgtccctcttcaaccgctttgactgcttcatcgtgtgtgggggcatt
ctggagaccatcctggtggagaccaagatcatgtctcccttgggcatctctgtactgaga
tgtgtccggctactgcggatatttaaaatcacaaggtactggaactccttaagcaacctg
gtggcatccttgctgaattctgtgcgctccattgcctccctgctgctactcctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggaggaaagttcaactttgat
gagatgcagactcggaggagcacatttgataactttcctcagtccctcctcaccgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aactatatcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgag
agcctcacatctgcccaaaaggaggaggaagaagagaaggagagaaagaagctggccagg
actgccagcccagagaaaaagcaagagataatggaaaagccagctgtggaggaaactaag
gaggagaaaattgagctgaaatccattacagctgatggagagtccccacccaccaccaag
atcaacatggatgacctccagcccaatgaaaatgaagataagagtccctaccccaaccca
gaaaatacaggagaagacgatgaagaggagcctgagatgcctgtgggcccccgcccacga
ccactctctgagctgcaccttaaggaaaaggcagtgcccatgccagaagccagtgcattt
ttcatcttcagccccaacaacagatttcgcctccagtgccaccgcattgtcaatgacacg
atcttcaccaacctgatcctcttcttcattctgctcagcagcatttccctggcagctgag
gaccctgtccagcacacctccttcaggaaccatattctgttttattttgacattgttttc
actaccattttcaccattgaaattgctctgaagatcctaggcaatgcagactatgtcttc
actagtatctttacattagaaattatccttaagatgactgcttatggggctttcctacac
aagggctctttctgccggaactacttcaacatcttggacctgctggtggtcagcgtgtcc
ctcatctcctttggcatccagtccagtgcaattaatgtggtgaagatcttgcgagttctg
cgagtcctcaggcccctgagggccatcaacagggccaaggggctaaagcacgtggtccag
tgcgtgtttgtcgccatccggaccatagggaatatcgtgattgtcaccacgctgctccag
ttcatgttcgcctgcatcggggtccagcttttcaagggaaagctctacacctgttcagat
agttccaagcagaccgaggcggaatgcaagggtaactacatcacatacaaggatggggaa
gttgaccaccccatcatccagcctcgcagctgggaaaacagcaagtttgactttgacaat
gttctggcagccatgatggcgctctttaccgtctccacctttgaggggtggccagagctg
ctgtaccgctccatcgactcccacacagaagacaagggccccatctacaactaccgtgtg
gagatctccatctttttcatcatctacatcatcatcattgccttcttcatgatgaacatc
ttcgtgggttttgtcatcgtcaccttccaggagcagggggagcaggaatacaagaactgt
gaactggacaagaaccagcgacagtgtgtggaatatgccctcaaggcccggcccctgcgg
aggtacatccccaaaaaccagcaccagtacaaagtgtggtacgtggtcaactccacctac
tttgaatacctgatgttcgtcctcatcctgctcaacaccatctgcttggcaatgcagcac
tatggccagagctgcctattcaaaatcgccatgaacatcctcaacatgctcttcactggc
ctcttcactgtggagatgattctgaagctcattgccttcaaacccaagggttactttagt
gatccctggaatgtttttgacttcctcatcgtaattggcagcataattgacgtcattctc
agtgaaactaatcactatttctgtgatgcatggaatacatttgacgccttgattgttgtg
ggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacccaatgctct
ccctttatgaacgcagaggagaactcccgcatctccatcaccttcttccgcctcttccgg
gtcatgcgcctggtcaagctgctaagccgtggggagggcatccggaccctgctgtggacc
ttcatcaagtccttccaggctttgccctatgtggcccttctgatagtgatgctgttcttc
atctacgcagtgatcgggatgcaggtgtttgggaaaattgccctgaatgacaccacagag
atcaaccggaacaacaactttcagaccttcccccaagctgtgctccttctcttcaggtgt
gccacaggggaggcatggcaagacatcatgctggcctgcatgccagggaagaagtgtgcc
cccgagtcagagcccagcaacagcacggaaggggaaacgccctgtggcagcagttttgcc
gtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctctttgta
gctgtcatcatggacaactttgactacctgacaagagactggtcaatccttggtccccat
catctggatgaatttaaaagaatctgggcagagtatgatcctgaagctaagggtcgtatc
aaacacctagatgtggtgaccctgctccggcggattcagcccccactgggttttgggaag
ctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaacatgcctctgaacagt
gatgggactgtcatgttcaatgccaccctgtttgccctagtccggacagccctgcggatc
aaaacagaagggaacctagaacaagccaatgaggagctgcgggccataatcaagaagatc
tggaagcgtaccagcatgaagctgctagaccaagtggtgccccctgcaggtgatgatgag
gtcaccgttggcaagttttatgctactttcctgatccaagagtacttccggaaattcaag
aagcgcaaagagcagggccttgtgggcaagccttcccaaaggaacgccctgtccttgcag
gctggcttgcgcacgctgcatgacattgggcctgagatccgacgggccatctctggagat
ctgacagctgaggaggagctggacaaggccatgaaggaggctgtgtctgctgcctccgaa
gatgacatcttcaggagggccggtggcctgttcggcaaccacgtcagctactaccaaagc
gacggccggagcgccttcccccagaccttcaccacccagcgcccactgcacatcaacaag
gcgggtaacagccaaggcgacaccgagtcgccatcccacgagaaactggtggactccacc
ttcacccccagcagctactcgtccactggctccaacgccaacatcaacaatgccaacaac
actgccctgggccgcttcccccgtcccgctggctaccccagcgcagtcagcaccgtggag
ggccatgggccccccttgtctcctgctgtccgggtacaggaggcagcatggaagctcagc
tccaagaggtgccactcccgggagagccagatagccatggtgtgtcaggaggaggtctct
caggacgagacctatgacgtgaagataagtgaagacactgagtactgcagcgagcccagc
ctgatctccacagagatgctctcctatcaggatgatgaaaatcggcaattaacaccaccg
gaggaggacaagagagatatccggcaatctccaaagaggggcttcctccgctctgcctca
ctaggtcgaagggcctccttccacctggaatgtctgaagcgacagaagaatcaaggggga
gacatctctcagaagacagtcctgcccttgcatctggttcatcatcaggcattggcggtg
gcaggcctgagccccctcctccagagaagccattcccccagcacatcccccaggccctgt
gccaccccaccagccactccaggcagccgaggctggcccccacagcctatccccaccctg
cggctggagggtgccgaatccagcgagaaactcaacagcagcttcccgtccatccactgc
agctcctggtctggggagcccacaccctgtggtggaggtggcagcaccatccggagagcc
cggccagtgtccctcactgtacctggccaggctggggcccagggcaggcagttccacggc
agtgccagcagcctggtagaagcggtcttgatttcagaaggactggggcagtttgctcaa
gatcccaagtttattgaggtcacaacccaggagctggctgacgcctgtgacatgaccata
gaggagatggagaacgccgcagacaacatcctcagtgggggcgcccagcagagccccaat
ggcaccctactacctttcgttaactgcagggacccagggcaggacagagcagagggccaa
gagggcgagacctgcgcgcccaccctgacgtgtcggaagaccaggacagcagagcccacg
tcggcagcctgtagtagctag

DBGET integrated database retrieval system