KEGG   Panthera tigris altaica (Amur tiger): 102956395
Entry
102956395         CDS       T02988                                 

Gene name
TPMT
Definition
(RefSeq) thiopurine S-methyltransferase
  KO
K00569  thiopurine S-methyltransferase [EC:2.1.1.67]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102956395 (TPMT)
Enzymes [BR:ptg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.67  thiopurine S-methyltransferase
     102956395 (TPMT)
SSDB
Motif
Pfam: TPMT Methyltransf_25 Methyltransf_11
Other DBs
NCBI-GeneID: 102956395
NCBI-ProteinID: XP_007089828
LinkDB
Position
Un
AA seq 245 aa
MDDASTLIDVKEYSDTEVQKNRVLTLEEWREKWVDGKIGFHQEQGHQLLKKHLDTFLKGE
NVLRVFFPLCGKAVEMKWFADRGHCVVGVEISELGIREFFTEQNLSYSEEPIMEIPGAKV
FKNSSGNISLYCCNLFDLPRVNIGKFDRIWDRGALVAVNPGDRKCYTDIMLSLTRKGFRY
LLAVLSYDPTKHPGPPFYVPDAEIKNLFGSTCNIHCLEKVDVFEERHKSWGIDYIVEKLY
LLTEK
NT seq 738 nt   +upstreamnt  +downstreamnt
atggatgatgcaagcactttaattgatgttaaagagtactccgataccgaggtacagaaa
aaccgagtactaactctggaagaatggcgagaaaagtgggtggacggcaaaattggattt
catcaagaacaaggacatcaattattaaagaagcatttggatactttccttaaaggcgag
aatgttctgagagtattttttcctctttgtggaaaagcagttgagatgaaatggtttgcg
gaccgaggacactgtgtagtgggtgtggaaatcagtgagcttgggattcgggaatttttt
acagagcagaatctttcttactcagaagagcccatcatggaaattcctggagccaaagta
ttcaagaattcttcagggaacatttcactgtactgttgcaacctttttgatcttcccaga
gtgaacattggcaaattcgacaggatctgggatagaggagcattagttgctgttaaccca
ggcgatcgtaaatgctatacagatataatgctgtccctaacgaggaaagggtttcgctac
ctcttggctgttctttcttatgatcccactaaacatccaggcccaccgttttatgttcca
gatgctgaaattaaaaacttgtttggttcaacatgcaacattcattgccttgagaaggtt
gatgtttttgaagaacgacataaaagttggggaattgactacattgttgaaaagttgtat
ctacttacggaaaagtaa

DBGET integrated database retrieval system