KEGG   Panthera tigris altaica (Amur tiger): 102956541Help
Entry
102956541         CDS       T02988                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00010  Glycolysis / Gluconeogenesis
ptg00053  Ascorbate and aldarate metabolism
ptg00071  Fatty acid degradation
ptg00280  Valine, leucine and isoleucine degradation
ptg00310  Lysine degradation
ptg00330  Arginine and proline metabolism
ptg00340  Histidine metabolism
ptg00380  Tryptophan metabolism
ptg00410  beta-Alanine metabolism
ptg00561  Glycerolipid metabolism
ptg00620  Pyruvate metabolism
ptg01100  Metabolic pathways
Module
ptg_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102956541 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102956541 (ALDH2)
   00620 Pyruvate metabolism
    102956541 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102956541 (ALDH2)
   00561 Glycerolipid metabolism
    102956541 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102956541 (ALDH2)
   00310 Lysine degradation
    102956541 (ALDH2)
   00330 Arginine and proline metabolism
    102956541 (ALDH2)
   00340 Histidine metabolism
    102956541 (ALDH2)
   00380 Tryptophan metabolism
    102956541 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102956541 (ALDH2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102956541 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 102956541
NCBI-ProteinID: XP_007079670
LinkDB All DBs
Position
Un
AA seq 422 aa AA seqDB search
MDASDRGRLLHRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADK
YHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTP
LTALYVANLIKEAGFPPGVVNIIPGFGPTAGAAIASHQDVDKVAFTGSTEVGHLIQIAAG
SSNLKRVTLELGGKSPNIIMSDADMNWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEF
VERSVARAKSRVVGNPFDSQTEQGPQVDKTQFQKVLGYIKSGKEEGAKLLCGGGAAADRG
YFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDK
ANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacgcatccgataggggccgcctgctgcaccgcctggctgatctgattgagcgggac
cggacctacctggcagccttggagacgctggataacggcaagccctacgtcatctcctac
ctggtggatttggacatggtccttaaatgcctccgttattatgctggctgggctgataag
taccatgggaaaaccattcccatcgatggggacttcttcagttatacccgccatgaaccc
gtcggggtgtgcgggcagatcattccgtggaacttcccgctcctgatgcaagcctggaaa
ctgggcccagccctggcgaccggaaacgtggttgtgatgaaggtggctgagcagactcca
ctcaccgccctctacgtggccaacctcattaaggaggctggctttccccctggtgtggtc
aatattatccctggatttggccccacagctggggctgccatcgcctcccatcaggatgtg
gacaaagtagccttcacgggctccactgaggttggccacctgatccagattgctgcaggg
agcagtaacctcaagagagtgaccctggagctggggggaaagagccccaatatcattatg
tcggatgcagacatgaactgggccgtggagcaggcccactttgccctgttcttcaaccag
ggccagtgctgctgtgcgggctcccggacctttgtgcaagaagatgtttatgctgagttt
gtggagcggagtgtcgcccgggccaagtctcgtgtagttgggaacccctttgacagccag
acggagcaggggccacaggtggacaaaactcagtttcagaaggtcctcggttatatcaaa
tctgggaaggaggagggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggc
tacttcatccagcccactgtgttcggagatgtgcaagacggcatgaccatcgccaaggag
gagatctttgggccagtgatgcagatcctgaagttcaagaccatagaggaagtcattggg
agagccaacaattccaagtatgggctggctgcagctgtcttcaccaaggacttggacaag
gccaattatctgtcccaagccctccaggctggcactgtgtgggtcaactgctatgatgtg
tttggggcccagtcaccgttcggaggctacaagatgtccgggaatggccgggagctagga
gagtatgggctgcaggcatacactgaagtgaaaacggtcacgatcaaagtgcctcagaag
aactcctga

DBGET integrated database retrieval system