KEGG   Panthera tigris altaica (Amur tiger): 102956554
Entry
102956554         CDS       T02988                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04915  Estrogen signaling pathway
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05223  Non-small cell lung cancer
ptg05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102956554 (TGFA)
   04012 ErbB signaling pathway
    102956554 (TGFA)
   04014 Ras signaling pathway
    102956554 (TGFA)
   04151 PI3K-Akt signaling pathway
    102956554 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102956554 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102956554 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102956554 (TGFA)
   05212 Pancreatic cancer
    102956554 (TGFA)
   05225 Hepatocellular carcinoma
    102956554 (TGFA)
   05214 Glioma
    102956554 (TGFA)
   05211 Renal cell carcinoma
    102956554 (TGFA)
   05215 Prostate cancer
    102956554 (TGFA)
   05223 Non-small cell lung cancer
    102956554 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102956554 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 102956554
NCBI-ProteinID: XP_007083573
LinkDB
Position
Un
AA seq 159 aa
MTDRIWGQGGRLQGLLLAVCQALENSTSALSDPPVAAAVVSHFNDCPDSHSQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIACVLI
HCCQVRKHCEWCQALICRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactgaccggatatggggccagggagggaggctgcaaggtcttctgttggctgtgtgc
caggccctggagaacagcacgtctgccctgagtgacccgcctgtggccgcagctgtggtg
tcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgcaga
tttttggtgcaggaagacaagccagcatgtgtctgccattctgggtatgttggtgcacgc
tgtgagcatgccgacctcctggctgtggtggccgccagccagaagaagcaagccatcacc
gccttggtggtggtctccatcgtggccctggctgtcctcatcatcgcatgtgtgctgata
cactgctgccaggtccggaaacactgtgagtggtgccaggccctcatctgccggcacgag
aagcccagtgccctgctgaagggaaggactgcttgctgccactcagagacagtggtctga

DBGET integrated database retrieval system