KEGG   Panthera tigris altaica (Amur tiger): 102956698Help
Entry
102956698         CDS       T02988                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg05164  Influenza A
ptg05202  Transcriptional misregulation in cancer
ptg05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    102956698 (TMPRSS2)
   05215 Prostate cancer
    102956698 (TMPRSS2)
  09167 Infectious diseases
   05164 Influenza A
    102956698 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptg01002]
    102956698 (TMPRSS2)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102956698 (TMPRSS2)
Peptidases [BR:ptg01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102956698 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 SRCR Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 102956698
NCBI-ProteinID: XP_015396688
LinkDB All DBs
Position
Un
AA seq 518 aa AA seqDB search
MALNSGPPPGVGPFYENHGYQPEGLYPPRPAVVPSAYSVYPAPYYPPAVPQYAPRVLTHT
STPSSHTQPKSPSGTVCTSKAKKVLCITFTLGAVLAGAVLAAVLLWKFMENKCLVSGIEC
GSSGTCISPAHWCDGVLHCPSGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWSEGY
GRAACQDMGYRNSFYSSRGVADDSGATSFMRVNASAHHVDLYKKLYHSDVCSSKTVVSLR
CIGKQFLVSTAPLLFFSKGSTLYLQKCIPCVWGGGVMGWDVSEPCARSVPQLHSRNTFLE
LRCPGDASGLGARDAAVLRGQAISGKPLNNPRHWTAFVGILRQSFMFYGHGYRVGKVISH
PNYDSKSKNNDIALMKLQTPLTFDDKVKPVCLPNPGLMLEPEQPCWISGWGATHEKGKTS
DELNAVMVPLIEPWRCNSKYVYNNLVTPAMICAGYLQGTIDSCQGDSGGPLVTMKSHIWW
LIGDTSWGSGCAKANRPGVYGNVTVFTDWIYRQMRANG
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaactcagggcccccgccaggagtcggacctttctacgaaaaccatggatac
cagcctgaaggcctgtaccccccgcggcccgccgtggtccccagcgcctactcggtgtat
ccggctccctactacccgcccgcggtgccccagtacgcgccgagggtgctgacgcatact
tccacgcccagcagccacacgcagcccaagtccccgtcggggacagtgtgcacctcaaag
gcgaagaaagtgctgtgtatcaccttcaccttgggggccgtcctggcgggagccgtgctg
gccgccgtcctgctctggaagttcatggagaacaagtgcttggtgtccgggatcgagtgc
gggtcctcgggaacctgcatcagccccgctcactggtgtgacggggtcctgcactgcccc
agcggggaggacgagaaccgatgcgtgcgcctctacggaccgaacttcatcctccaggtg
tattcgtcccagaggaagtcgtggcaccccgtgtgtcaggatgactggagcgagggctac
ggaagggccgcgtgccaggacatgggctaccggaatagtttctattctagccgcggagta
gcggatgacagtggggccaccagctttatgagggtgaacgcaagtgctcaccatgtggat
ctctataagaaactgtaccacagtgatgtctgttcgtcaaaaacggtggtttctttacgc
tgtataggtaagcaattcctggtttccaccgcccccctcctttttttctccaaagggagc
accctgtaccttcagaaatgcatcccctgcgtctggggaggcggggtgatggggtgggat
gtgtctgagccttgcgcccggtccgtaccccagctccactcaaggaacacctttctggaa
ctgcggtgtcctggagatgcctccggcctcggggccagggacgcagccgtcctgcgggga
caggcaatctcaggaaaaccactgaacaacccacggcactggacggccttcgtgggaatt
ttgaggcaatctttcatgttctacggacacgggtaccgagtgggaaaagtgatctcccac
ccgaactatgattccaagagcaagaacaatgacatcgctcttatgaagttgcagacgcct
ctgacttttgatgacaaagtgaaaccggtgtgcctgcccaacccaggcttgatgctcgag
ccggaacagccgtgttggatttccgggtggggggccacccacgagaaagggaaaacctcg
gacgagctgaacgccgtcatggtgcccctcatcgagccctggcgttgcaacagcaagtac
gtctacaacaacctggtcacgccggccatgatctgcgcgggctacctgcaggggaccatc
gattcctgccagggtgacagtggaggccccctggtcactatgaagagtcacatctggtgg
ctgattggggacacgagctggggatcaggctgtgccaaagccaacagaccaggcgtgtat
ggaaatgtgacagtatttacggactggatttatcgacaaatgagggcaaacggctaa

DBGET integrated database retrieval system