KEGG   Panthera tigris altaica (Amur tiger): 102956793
Entry
102956793         CDS       T02988                                 

Gene name
TNFRSF1A
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04061  Viral protein interaction with cytokine and cytokine receptor
ptg04064  NF-kappa B signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04150  mTOR signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04380  Osteoclast differentiation
ptg04668  TNF signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102956793 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    102956793 (TNFRSF1A)
   04668 TNF signaling pathway
    102956793 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    102956793 (TNFRSF1A)
   04150 mTOR signaling pathway
    102956793 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102956793 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102956793 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102956793 (TNFRSF1A)
   04215 Apoptosis - multiple species
    102956793 (TNFRSF1A)
   04217 Necroptosis
    102956793 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102956793 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102956793 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102956793 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    102956793 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    102956793 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102956793 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102956793 (TNFRSF1A)
   04931 Insulin resistance
    102956793 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102956793 (TNFRSF1A)
   05152 Tuberculosis
    102956793 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102956793 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    102956793 (TNFRSF1A)
   05160 Hepatitis C
    102956793 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    102956793 (TNFRSF1A)
   05164 Influenza A
    102956793 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    102956793 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    102956793 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102956793 (TNFRSF1A)
   05165 Human papillomavirus infection
    102956793 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102956793 (TNFRSF1A)
   05142 Chagas disease
    102956793 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102956793 (TNFRSF1A)
   04090 CD molecules [BR:ptg04090]
    102956793 (TNFRSF1A)
Cytokine receptors [BR:ptg04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102956793 (TNFRSF1A)
CD molecules [BR:ptg04090]
 Proteins
  102956793 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 102956793
NCBI-ProteinID: XP_007089751
LinkDB
Position
Un
AA seq 265 aa
MEMGWWVLLALLVEIYPLRVTGLVPHLRDREKRAIPCPQGKYIHPQDNSICCTKCHKGTY
LYNDCAGPGLDTDCRECENGTFTASENYLRQCLSCSKCRKEMYQVEISPCTVYRDTVCGC
RKNQYRYYWSETHFQCLNCSLCLNGTVQISCKETQNTVCTCHAGFFLRGNECVSCVNCKK
NTECTKLCVPIVETVKDPQDPGTTVLLPLVIFFGICVLSFSIGLMCRYQRRKSKLFSIVC
GKSTPTKEGEPQPLATGPGFSLIPS
NT seq 795 nt   +upstreamnt  +downstreamnt
atggagatgggctggtgggtgcttctggctctgttggtggaaatatacccattaagggtt
actggactggtccctcacctcagggaccgggagaagagagctattccgtgtccccaagga
aaatatattcaccctcaagataattccatttgctgtacgaagtgccacaaagggacctac
ctgtacaatgactgtgccggcccagggctggacacggactgcagagaatgtgaaaacggc
acatttactgcttcagagaactacctcagacagtgccttagctgctccaaatgccgaaaa
gaaatgtaccaggtggagatatctccttgcacagtgtaccgggacaccgtgtgtggctgc
aggaagaaccagtaccggtattactggagtgaaacccatttccagtgcctaaactgcagc
ctctgcctcaacggcacggtgcagatctcctgcaaggagacacagaatactgtatgcacc
tgccacgcggggttctttctaagagggaatgaatgcgtctcttgtgttaactgtaagaaa
aacacagagtgtacgaagttgtgcgtacccatcgtggaaactgttaaggaccctcaggac
ccaggcaccacagtgctgctgcctctcgtgatcttcttcggcatttgcgttttatccttc
tccattggtttaatgtgccgctaccaacggcggaagtccaagctcttctccattgtttgt
gggaaatcaacacctacaaaagagggagagcctcagcccctggccacaggtccaggcttc
agtctcatccccagc

DBGET integrated database retrieval system