KEGG   Panthera tigris altaica (Amur tiger): 102956808
Entry
102956808         CDS       T02988                                 

Gene name
MAP2K2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04024  cAMP signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04218  Cellular senescence
ptg04270  Vascular smooth muscle contraction
ptg04370  VEGF signaling pathway
ptg04371  Apelin signaling pathway
ptg04540  Gap junction
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04720  Long-term potentiation
ptg04722  Neurotrophin signaling pathway
ptg04730  Long-term depression
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04912  GnRH signaling pathway
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg05010  Alzheimer disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05216  Thyroid cancer
ptg05218  Melanoma
ptg05219  Bladder cancer
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102956808 (MAP2K2)
   04012 ErbB signaling pathway
    102956808 (MAP2K2)
   04014 Ras signaling pathway
    102956808 (MAP2K2)
   04015 Rap1 signaling pathway
    102956808 (MAP2K2)
   04370 VEGF signaling pathway
    102956808 (MAP2K2)
   04371 Apelin signaling pathway
    102956808 (MAP2K2)
   04066 HIF-1 signaling pathway
    102956808 (MAP2K2)
   04068 FoxO signaling pathway
    102956808 (MAP2K2)
   04072 Phospholipase D signaling pathway
    102956808 (MAP2K2)
   04071 Sphingolipid signaling pathway
    102956808 (MAP2K2)
   04024 cAMP signaling pathway
    102956808 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    102956808 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    102956808 (MAP2K2)
   04150 mTOR signaling pathway
    102956808 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102956808 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    102956808 (MAP2K2)
   04218 Cellular senescence
    102956808 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102956808 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102956808 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102956808 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102956808 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    102956808 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    102956808 (MAP2K2)
   04660 T cell receptor signaling pathway
    102956808 (MAP2K2)
   04662 B cell receptor signaling pathway
    102956808 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    102956808 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102956808 (MAP2K2)
   04929 GnRH secretion
    102956808 (MAP2K2)
   04912 GnRH signaling pathway
    102956808 (MAP2K2)
   04915 Estrogen signaling pathway
    102956808 (MAP2K2)
   04917 Prolactin signaling pathway
    102956808 (MAP2K2)
   04921 Oxytocin signaling pathway
    102956808 (MAP2K2)
   04926 Relaxin signaling pathway
    102956808 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    102956808 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    102956808 (MAP2K2)
   04916 Melanogenesis
    102956808 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102956808 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    102956808 (MAP2K2)
   04730 Long-term depression
    102956808 (MAP2K2)
   04722 Neurotrophin signaling pathway
    102956808 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102956808 (MAP2K2)
   05206 MicroRNAs in cancer
    102956808 (MAP2K2)
   05205 Proteoglycans in cancer
    102956808 (MAP2K2)
   05230 Central carbon metabolism in cancer
    102956808 (MAP2K2)
   05231 Choline metabolism in cancer
    102956808 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102956808 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102956808 (MAP2K2)
   05225 Hepatocellular carcinoma
    102956808 (MAP2K2)
   05226 Gastric cancer
    102956808 (MAP2K2)
   05214 Glioma
    102956808 (MAP2K2)
   05216 Thyroid cancer
    102956808 (MAP2K2)
   05221 Acute myeloid leukemia
    102956808 (MAP2K2)
   05220 Chronic myeloid leukemia
    102956808 (MAP2K2)
   05218 Melanoma
    102956808 (MAP2K2)
   05211 Renal cell carcinoma
    102956808 (MAP2K2)
   05219 Bladder cancer
    102956808 (MAP2K2)
   05215 Prostate cancer
    102956808 (MAP2K2)
   05213 Endometrial cancer
    102956808 (MAP2K2)
   05224 Breast cancer
    102956808 (MAP2K2)
   05223 Non-small cell lung cancer
    102956808 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102956808 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    102956808 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102956808 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102956808 (MAP2K2)
   05135 Yersinia infection
    102956808 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102956808 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    102956808 (MAP2K2)
   05161 Hepatitis B
    102956808 (MAP2K2)
   05160 Hepatitis C
    102956808 (MAP2K2)
   05164 Influenza A
    102956808 (MAP2K2)
   05163 Human cytomegalovirus infection
    102956808 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102956808 (MAP2K2)
   05165 Human papillomavirus infection
    102956808 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102956808 (MAP2K2)
   01522 Endocrine resistance
    102956808 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102956808 (MAP2K2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102956808 (MAP2K2)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: STE group
  STE7 family
   102956808 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 102956808
NCBI-ProteinID: XP_015399708
LinkDB
Position
Un
AA seq 508 aa
MFLASPCPWGLCRANLVDLQKKLAELELDEQQKKRLEAFLTQKAKVGELKDDDFERISEL
GAGNGGVVTKVQHRPSGLIMARKVRGDCGLSVVWAPCGCPPSTVSERSCARGHLVDAWNK
KAVLAASAVRGCDSTVLGVCVTPGQWRGKRVVLVFGEPGPNTDLPARQLSAAETRRVLAL
QLGRSSAAPLKFSVESRTVRGSRPVVRAAEILGGLDREPRPQLFPASRVWLWSGLRVPWR
RLSSSSWQAGKCSAVLPASRCPSGTRPLHRRPRLAHRPEPAFSPLCRPQDGGSLDQVLKE
AKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLID
SMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEATFGR
PMVDGAEGEPHSISPRPRPPGRPVSGMARIGNFGLDRQCCPSGVSWAPEAFGGGPPGAVP
CPTGGPGPPHRELWTGQGFCPPRGVLGT
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgttcttggctagcccttgcccttggggtctttgcagagcaaacttggtggacctccag
aagaagctagcagagcttgaactcgacgagcagcagaagaagcgtctagaagccttcctc
acccagaaggccaaggtcggagagctcaaggacgatgacttcgaaaggatctcggaactg
ggggccgggaacggcggggtggtcaccaaggtccaacacagaccctccggcctcatcatg
gcgagaaaggtgagaggcgattgtggcctctcagtcgtgtgggccccgtgtggctgcccg
cccagcacggtgtcggagcggagctgtgcccgcgggcacttggtggacgcttggaacaag
aaggccgtcctcgcagccagcgcagttcggggctgcgactccacagtccttggcgtctgc
gtgaccccagggcagtggcgtggaaagcgcgtggtgttggtgttcggggagcctggcccc
aacacggacttgcccgcccgccagctgagtgccgccgagacccgcagagttctagccctg
cagctcggtcgttcatctgcagcccctttgaagttctcggtcgagagccgcaccgtccgc
ggcagccgccccgtggtcagggcagccgagatcctcggtggcctggacagggaaccacgg
cctcagctctttcccgcgagtcgcgtctggctgtggtctggcctccgtgtcccgtggagg
agattgagctccagctcctggcaagcggggaagtgctccgctgtcctgcctgcttcccgg
tgtccctctgggactcgtcctctgcaccgcaggccccgcctggcccaccgcccagagccg
gctttctcccctctgtgccgtccccaggacggcggttctctggaccaggtgttgaaagaa
gccaagagaattcccgaggagatcctggggaaggtcagcattgcggttctccggggtttg
gcgtatctccgggaaaagcaccagatcatgcaccgagatgtgaaaccgtccaacatcctc
gtcaactcccgaggggagatcaagctgtgcgattttggggtgagcgggcagctcatcgac
tccatggccaactccttcgtgggaactcggtcctacatgtctccggagcggttgcagggc
acgcactactcggtgcagtcggacatctggagcatgggcctgtccctggtggagctgtcc
atcggaaggtaccccatccccccgccggacgccaaggagctggaggccacattcggccgg
cccatggttgacggggcagaaggagagcctcacagcatctcgccacggcccagaccgcct
ggacgccccgtcagtggtatggcccgaatcgggaactttggactggacaggcagtgttgc
ccgtccggggtgtcctgggcacctgaggcttttgggggcgggcccccgggcgccgtcccg
tgccccaccgggggtcccgggccccctcatcgggaactttggactggacaggggttctgt
cccccccggggtgtcctgggcacctga

KEGG   Panthera tigris altaica (Amur tiger): 102969757
Entry
102969757         CDS       T02988                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04114  Oocyte meiosis
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04218  Cellular senescence
ptg04270  Vascular smooth muscle contraction
ptg04370  VEGF signaling pathway
ptg04371  Apelin signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04540  Gap junction
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04720  Long-term potentiation
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04726  Serotonergic synapse
ptg04730  Long-term depression
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04912  GnRH signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04926  Relaxin signaling pathway
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04929  GnRH secretion
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg05010  Alzheimer disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05034  Alcoholism
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05216  Thyroid cancer
ptg05218  Melanoma
ptg05219  Bladder cancer
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102969757 (MAP2K1)
   04012 ErbB signaling pathway
    102969757 (MAP2K1)
   04014 Ras signaling pathway
    102969757 (MAP2K1)
   04015 Rap1 signaling pathway
    102969757 (MAP2K1)
   04370 VEGF signaling pathway
    102969757 (MAP2K1)
   04371 Apelin signaling pathway
    102969757 (MAP2K1)
   04668 TNF signaling pathway
    102969757 (MAP2K1)
   04066 HIF-1 signaling pathway
    102969757 (MAP2K1)
   04068 FoxO signaling pathway
    102969757 (MAP2K1)
   04072 Phospholipase D signaling pathway
    102969757 (MAP2K1)
   04071 Sphingolipid signaling pathway
    102969757 (MAP2K1)
   04024 cAMP signaling pathway
    102969757 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    102969757 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    102969757 (MAP2K1)
   04150 mTOR signaling pathway
    102969757 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102969757 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102969757 (MAP2K1)
   04210 Apoptosis
    102969757 (MAP2K1)
   04218 Cellular senescence
    102969757 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102969757 (MAP2K1)
   04540 Gap junction
    102969757 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102969757 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102969757 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102969757 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    102969757 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    102969757 (MAP2K1)
   04660 T cell receptor signaling pathway
    102969757 (MAP2K1)
   04662 B cell receptor signaling pathway
    102969757 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    102969757 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    102969757 (MAP2K1)
   04062 Chemokine signaling pathway
    102969757 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102969757 (MAP2K1)
   04929 GnRH secretion
    102969757 (MAP2K1)
   04912 GnRH signaling pathway
    102969757 (MAP2K1)
   04915 Estrogen signaling pathway
    102969757 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    102969757 (MAP2K1)
   04917 Prolactin signaling pathway
    102969757 (MAP2K1)
   04921 Oxytocin signaling pathway
    102969757 (MAP2K1)
   04926 Relaxin signaling pathway
    102969757 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    102969757 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    102969757 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    102969757 (MAP2K1)
   04916 Melanogenesis
    102969757 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102969757 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    102969757 (MAP2K1)
   04726 Serotonergic synapse
    102969757 (MAP2K1)
   04720 Long-term potentiation
    102969757 (MAP2K1)
   04730 Long-term depression
    102969757 (MAP2K1)
   04722 Neurotrophin signaling pathway
    102969757 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102969757 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102969757 (MAP2K1)
   05206 MicroRNAs in cancer
    102969757 (MAP2K1)
   05205 Proteoglycans in cancer
    102969757 (MAP2K1)
   05230 Central carbon metabolism in cancer
    102969757 (MAP2K1)
   05231 Choline metabolism in cancer
    102969757 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102969757 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102969757 (MAP2K1)
   05212 Pancreatic cancer
    102969757 (MAP2K1)
   05225 Hepatocellular carcinoma
    102969757 (MAP2K1)
   05226 Gastric cancer
    102969757 (MAP2K1)
   05214 Glioma
    102969757 (MAP2K1)
   05216 Thyroid cancer
    102969757 (MAP2K1)
   05221 Acute myeloid leukemia
    102969757 (MAP2K1)
   05220 Chronic myeloid leukemia
    102969757 (MAP2K1)
   05218 Melanoma
    102969757 (MAP2K1)
   05211 Renal cell carcinoma
    102969757 (MAP2K1)
   05219 Bladder cancer
    102969757 (MAP2K1)
   05215 Prostate cancer
    102969757 (MAP2K1)
   05213 Endometrial cancer
    102969757 (MAP2K1)
   05224 Breast cancer
    102969757 (MAP2K1)
   05223 Non-small cell lung cancer
    102969757 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102969757 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    102969757 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    102969757 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102969757 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102969757 (MAP2K1)
   05135 Yersinia infection
    102969757 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102969757 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    102969757 (MAP2K1)
   05161 Hepatitis B
    102969757 (MAP2K1)
   05160 Hepatitis C
    102969757 (MAP2K1)
   05164 Influenza A
    102969757 (MAP2K1)
   05163 Human cytomegalovirus infection
    102969757 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102969757 (MAP2K1)
   05165 Human papillomavirus infection
    102969757 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102969757 (MAP2K1)
   01522 Endocrine resistance
    102969757 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102969757 (MAP2K1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102969757 (MAP2K1)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: STE group
  STE7 family
   102969757 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 102969757
NCBI-ProteinID: XP_007084590
LinkDB
Position
Un
AA seq 371 aa
MKLERTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVV
FKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISIC
MEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRG
EIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYP
IPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPP
PKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDGEEVDFAGWLCSTIGLN
QPSTPTHAAGV
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaagctggagaggaccaacctggaggccttgcagaagaagttggaggagctggagctc
gatgagcagcaacggaagcgcctggaggcctttcttacccagaagcagaaggtcggggaa
ttgaaggatgacgacttcgagaagatcagtgagctgggcgccggcaacggtggtgtggtg
ttcaaggtctcccataagccgtctggcctggtcatggccagaaagctaattcacctggag
atcaaacctgcaatccggaaccagatcataagggagctgcaggttctacatgagtgcaac
tccccatacatcgtgggcttctatggcgcgttctacagcgacggcgagatcagtatctgt
atggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaagaattcct
gaacaaattttaggaaaagttagcattgctgtaataaaaggtctgacatacctgagggag
aagcacaagattatgcacagagatgtcaagccttccaacatcctagtgaactcccgtggg
gagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggccaactcc
ttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattactccgtg
cagtcggacatctggagcatggggctatctctggttgagatggcagtcgggaggtatccc
atccctcctcccgatgccaaggagctggagctgatgtttgggtgccaagtggagggagat
gcggctgagacgccacccaggccgaggacccctggaaggcccctcagctcatatggaatg
gacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgagcctcct
ccaaagctgcccagtggagtattcagtctggaatttcaagattttgtgaataaatgcctc
ataaaaaacccagcagagagagcagatctgaaacaactcatggttcatgcctttatcaag
agatctgatggtgaggaagtggattttgcaggttggctctgctccaccatcggccttaac
cagccgagtacaccgacccacgcggccggcgtctaa

DBGET integrated database retrieval system