KEGG   Panthera tigris altaica (Amur tiger): 102956818
Entry
102956818         CDS       T02988                                 

Gene name
TXNDC12
Definition
(RefSeq) thioredoxin domain containing 12
  KO
K05360  protein-disulfide reductase (glutathione) [EC:1.8.4.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102956818 (TXNDC12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102956818 (TXNDC12)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.2  protein-disulfide reductase (glutathione)
     102956818 (TXNDC12)
Membrane trafficking [BR:ptg04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    102956818 (TXNDC12)
SSDB
Motif
Pfam: Thioredoxin_7 Thioredoxin Thioredoxin_2 Thioredox_DsbH Thioredoxin_9 Thioredoxin_8 AhpC-TSA
Other DBs
NCBI-GeneID: 102956818
NCBI-ProteinID: XP_007077271
LinkDB
Position
Un
AA seq 172 aa
MELRSHLGATCLLSFSFLLLITSSDGHIGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVI
IHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDP
SGKVRPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHLEDEL
NT seq 519 nt   +upstreamnt  +downstreamnt
atggagcttcggtctcatctcggggccacttgtttgctgagcttcagtttcctgcttctg
atcacctcttctgatggacatattgggcttggaaagggttttggagatcacattcattgg
aggacactagaagatgggaagaaggaagcagctgcaagtggcttgcccctaatggtgatc
atccataagtcctggtgtggagcttgcaaagctttaaagcccaaatttgcagaatctaca
gaaatttcagaactttcccataatttcgttatggtgaatcttgaggatgaagaagagccc
aaggatgaagatttcagccctgatgggggttatattccacgaatcctttttctggatccc
agtggcaaggtgcgtcctgaaatcatcaatgagaatggaaaccccagctacaagtatttc
tacgtcagtgctgaacaagttgttcaggggatgaaggaagctcaggaaaggctgactggt
gatgccttcagagagaaacatcttgaagatgagttgtaa

DBGET integrated database retrieval system