KEGG   Panthera tigris altaica (Amur tiger): 102956995
Entry
102956995         CDS       T02988                                 

Gene name
GSR
Definition
(RefSeq) glutathione-disulfide reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102956995 (GSR)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102956995 (GSR)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     102956995 (GSR)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 K_oxygenase FAD_binding_2
Other DBs
NCBI-GeneID: 102956995
NCBI-ProteinID: XP_007094037
LinkDB
Position
Un
AA seq 427 aa
HKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCESKFNWRVIKEKRDAYVSRLN
TIYQNNLTKSHIEIIHGHAAFTSDPKPTVEVSGNKYTAPHILIATGGVPSRPQESEIPGA
SLGITSDGFFQLEELPGRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRNFDSIIS
SNCTEELENSGIEVLKYSQVKEVKKTSSGLELCMVTSIPGRNPTLTTIPDVDCLLWAIGR
DPNSSGLNLNKVGIQTDDKGHIIVDEFQNTSVKGVYAVGDVCGKALLTPVAIAAGRKLAH
RLFECKKDSKLDYDNIPTVVFSHPPIGTVGLTEDEAIHKYGKENVKTYSTTFTPMYHAVT
KRKTKCVMKMVCATKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSS
EELVTLR
NT seq 1284 nt   +upstreamnt  +downstreamnt
cacaagctgggcggcacttgcgtgaatgttggatgtgtacccaaaaaggtaatgtggaac
acggctgtccattctgaattcatgcacgatcatgttgattatggctttcaaagttgtgag
agtaaattcaattggcgtgttataaaggaaaagcgtgatgcctatgtgagccgcctgaat
accatctatcaaaataacctaaccaagtcccatatagaaatcatccatggccatgcagca
ttcacaagtgatcccaagcccacagtagaagtcagtgggaacaaatacactgctcctcac
atcctgattgccactggtggcgtgccctctcgtcctcaggagagcgagatccctggtgcc
agcctaggaattaccagtgatggatttttccaactggaagagttgcctggtcgcagcgtc
attgtcggtgcgggttacattgctgtagaaatagctgggattctttctgctctgggttca
aagacatcgctgatgatacgccatgataaggtacttagaaattttgattcaattatcagt
tcaaactgcactgaagagctggagaattctggcatagaggtcctgaagtactcacaggtc
aaggaagttaaaaagacttcctcaggcttggaactctgcatggttacttcaattcctggt
aggaatcccaccttgaccacgattccagatgttgactgcctgctttgggccattgggcgg
gacccaaattccagtggcctgaatttgaacaaagtggggattcaaactgatgataaaggg
cacatcatagtagatgaattccagaataccagcgtaaaaggtgtctatgcagttggagat
gtgtgtggaaaagctcttctcactccagttgccatagctgctggccgaaaacttgcccat
agactttttgaatgcaaaaaagattccaaactagactatgacaacatccctaccgttgtc
ttcagccacccccctattggaacagtgggactcacggaagatgaggccattcataaatac
ggaaaagaaaatgtgaagacctattcaaccacctttaccccaatgtatcatgcagttacc
aaaaggaaaacaaaatgtgtgatgaaaatggtttgtgccaccaaagaggagaaggtggtt
gggatccatatgcaaggaatcgggtgtgatgaaatgctgcagggttttgctgttgcagtg
aaaatgggagcaacaaaagctgactttgacaacacagttgccattcaccctacctcgtca
gaagaactggtcacacttcgttga

DBGET integrated database retrieval system