KEGG   Panthera tigris altaica (Amur tiger): 102957307
Entry
102957307         CDS       T02988                                 

Gene name
NAT8B
Definition
(RefSeq) N-acetyltransferase 8B (putative, gene/pseudogene)
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102957307 (NAT8B)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     102957307 (NAT8B)
    2.3.1.-  
     102957307 (NAT8B)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_9 Acetyltransf_3 FR47 Acetyltransf_4 Acetyltransf_8 Acetyltransf_15 DuoxA
Other DBs
NCBI-GeneID: 102957307
NCBI-ProteinID: XP_007083498
LinkDB
Position
Un
AA seq 242 aa
MDFEIQAQQSSVAPYHIRKYRENDRTRVLDVFSQGMNEHIPTTFCHILKLPRTLVLLLGV
PLTLFLFSGSWVLALVASLILLAALRFLSRYPWTKFIAMSLRTDMSDITKTYLGKPGSCF
WVVEAEGQVVGIMGVLPATLQKEKLQLLHLCVAPEHRGQGIAKALVRTALQFARDQGYSQ
VILITSLVQHSAWALYQHMGFQKTHQFFSSMIWRLVAIPTFGFVYHLPSAGASEARGLGG
GL
NT seq 729 nt   +upstreamnt  +downstreamnt
atggactttgagattcaggctcagcagtcttccgtggctccttatcacatccgcaaatac
cgggagaacgaccgcacacgggtcctggatgtgttctcccagggaatgaatgagcacatc
cccaccaccttctgccacatcctgaagctgccccgaaccctggtgctcttgcttggggtg
cccctcacccttttcctgttctctggctcctgggtcctggcccttgtagccagcctcatc
ctccttgctgccctgagattcctctccagatacccctggaccaagtttatagccatgtct
ttgcgcacagatatgtctgacatcaccaagacctacttgggtaaacctggctcctgcttc
tgggtggttgaagctgaggggcaggtggtgggcattatgggcgttctgcctgccaccctg
cagaaggagaagttgcagctgcttcacctgtgtgtggccccagagcaccgaggccagggg
atagcgaaggccctggtcaggactgccctccagttcgcacgggaccaggggtacagccaa
gtcatcctcatcacctccctggtgcagcactcggcctgggccctctaccagcacatgggc
ttccagaaaacgcaccaattcttctcctccatgatctggaggctagtcgctattcctaca
tttggctttgtctaccacctcccctctgctggggcctctgaggcacggggtctgggaggg
ggcctgtga

DBGET integrated database retrieval system