KEGG   Panthera tigris altaica (Amur tiger): 102957506
Entry
102957506         CDS       T02988                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04061  Viral protein interaction with cytokine and cytokine receptor
ptg04151  PI3K-Akt signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg04940  Type I diabetes mellitus
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102957506 (IL2)
   04151 PI3K-Akt signaling pathway
    102957506 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102957506 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102957506 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102957506 (IL2)
   04660 T cell receptor signaling pathway
    102957506 (IL2)
   04658 Th1 and Th2 cell differentiation
    102957506 (IL2)
   04659 Th17 cell differentiation
    102957506 (IL2)
   04672 Intestinal immune network for IgA production
    102957506 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102957506 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102957506 (IL2)
   05321 Inflammatory bowel disease
    102957506 (IL2)
   05330 Allograft rejection
    102957506 (IL2)
   05332 Graft-versus-host disease
    102957506 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102957506 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102957506 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102957506 (IL2)
   05162 Measles
    102957506 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102957506 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102957506 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102957506 (IL2)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102957506 (IL2)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Haparin
  Cytokines
   102957506 (IL2)
SSDB
Motif
Pfam: IL2 Leg1 ICAT
Other DBs
NCBI-GeneID: 102957506
NCBI-ProteinID: XP_007087656
LinkDB
Position
Un
AA seq 154 aa
MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML
TFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS
ETRFTCKYDDETATIVEFLNKWITFCQSIFSTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaaaattcaactcttgtcttgcattgcactgactcttatactcgtcacaaacagt
gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat
ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc
acgtttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta
gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg
aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct
gaaacaagattcacatgtaaatatgatgatgagacagcaaccattgtagaatttctgaac
aaatggattaccttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system