KEGG   Panthera tigris altaica (Amur tiger): 102957558
Entry
102957558         CDS       T02988                                 

Gene name
IL10
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04061  Viral protein interaction with cytokine and cytokine receptor
ptg04068  FoxO signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04660  T cell receptor signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05150  Staphylococcus aureus infection
ptg05152  Tuberculosis
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102957558 (IL10)
   04068 FoxO signaling pathway
    102957558 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102957558 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102957558 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102957558 (IL10)
   04660 T cell receptor signaling pathway
    102957558 (IL10)
   04672 Intestinal immune network for IgA production
    102957558 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102957558 (IL10)
   05322 Systemic lupus erythematosus
    102957558 (IL10)
   05320 Autoimmune thyroid disease
    102957558 (IL10)
   05321 Inflammatory bowel disease
    102957558 (IL10)
   05330 Allograft rejection
    102957558 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102957558 (IL10)
   05133 Pertussis
    102957558 (IL10)
   05150 Staphylococcus aureus infection
    102957558 (IL10)
   05152 Tuberculosis
    102957558 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102957558 (IL10)
   05144 Malaria
    102957558 (IL10)
   05145 Toxoplasmosis
    102957558 (IL10)
   05140 Leishmaniasis
    102957558 (IL10)
   05142 Chagas disease
    102957558 (IL10)
   05143 African trypanosomiasis
    102957558 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102957558 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102957558 (IL10)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102957558 (IL10)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Cytokines
   102957558 (IL10)
SSDB
Motif
Pfam: IL10 IL22 CLZ
Other DBs
NCBI-GeneID: 102957558
NCBI-ProteinID: XP_007096169
LinkDB
Position
Un
AA seq 178 aa
MPSPALLCFLVFLAGVGASRHQSTLSEDNCTHFSVSLPHMLRELRAAFGKVKTFFQTKDE
LHSILLTRSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENEDPDIKQHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKVVEQVKSTFSKLQEKGVYKAMGEFDIFINYIEAYMTMKMKI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagcccagcacttctgtgtttcctggtcttcctggccggggtaggagccagccga
caccagagcaccctgtctgaggacaactgcacccacttctcagtcagcctgccgcacatg
ctccgagagctccgagctgccttcggcaaggtgaagactttctttcaaaccaaggacgag
ctgcacagcatattgttgactaggtccttgctggaggactttaagggttacctgggttgc
caagcgttgtccgagatgatccagttttacttggaggaggtgatgccccaggctgagaac
gaggacccagacatcaaacagcacgtgaactccctgggagaaaagctgaagaccctccgg
ctgagactgcggcgctgtcatcgatttctgccctgtgaaaacaagagcaaggtggtggag
caggtgaagagtacctttagtaagctccaagagaaaggtgtctacaaagccatgggtgag
tttgacatcttcatcaactacatagaagcttacatgacaatgaagatgaaaatctga

DBGET integrated database retrieval system