KEGG   Panthera tigris altaica (Amur tiger): 102957879
Entry
102957879         CDS       T02988                                 

Definition
(RefSeq) cytochrome P450 2C41-like
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00590  Arachidonic acid metabolism
ptg00591  Linoleic acid metabolism
ptg00830  Retinol metabolism
ptg01100  Metabolic pathways
ptg04726  Serotonergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102957879
   00590 Arachidonic acid metabolism
    102957879
   00591 Linoleic acid metabolism
    102957879
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102957879
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    102957879
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102957879
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102957879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ptg00199]
    102957879
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     102957879
Cytochrome P450 [BR:ptg00199]
 Cytochrome P450, animal type
  CYP2 family
   102957879
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102957879
NCBI-ProteinID: XP_015392146
LinkDB
Position
Un
AA seq 487 aa
MDPLVILVLCLSCWLLLSLWKQNIGKGKLPSGPHPLPFIGNILQVDVKNIGKSLCNLSKT
YGPVFTLYFGMKPAVVLHGYKAVKEALIDLGEEFSARGSFPLAERINKGHGILFANGKRW
KEMRRFCLMTLRNLGMGKSDLESRVQEEAYYLMEELRKTNALPCDPTFVLGCAACNMVCS
IIFQNRFDYTHQTLLGFLERFHENSKILSSSWVQIYNSFPALIDYLPGSHRKIFKNFTYT
YNYILEKIKEHQESLDINNPRDFIDYFLIKMKQENHSQQLEFTIENLIATASDLFGAGTK
TTSTTLRYXLLKPPEVTAKIQEEIGHVIGRHRSPCMQDRSRMPYMNAVLHEIQRYIDLIP
VNLPHAVTRDIKFRNYVIPKGTNVLISLTSVLRDDKEFPNPETFDPAHFLDDNGNFKKSD
YFMVFSAGKRICVGESLARMELFLFLTSILQNFTLKPVVDIKDLDTTPVASGFGHIPPPY
KICFVPL
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggatccacttgtgattctggtgctctgtctctcctgttggcttctcctttctctctgg
aaacagaacattgggaaggggaagctcccgtctggccctcatcctctcccttttattgga
aatatcctacaggtagatgtgaagaacatcggcaaatccttatgcaatctctcaaaaacc
tatggcccggttttcactctgtattttggcatgaagcctgctgttgtgctgcatggatat
aaggcagtgaaggaagccctgattgatctaggagaagagttttctgcaagaggaagtttc
ccattagctgaaagaattaataaaggacatggaatccttttcgccaatggaaagagatgg
aaggagatgcggcgtttctgcctcatgaccctgcggaatttggggatggggaagagtgac
cttgagagccgagttcaagaggaagcctactacctcatggaagagttgagaaaaaccaat
gccttaccctgtgaccccactttcgtcctgggctgtgctgcctgtaatatggtctgctcc
attattttccaaaatcgttttgattatacacatcagactttacttggcttcctggaaaga
tttcatgaaaacagcaagattttgagctcctcatgggtccagatctacaatagtttccct
gctctcattgattacctcccaggaagtcatcgcaaaatatttaaaaattttacttataca
tacaattatattttagagaaaatcaaagaacaccaagaatccttggacattaacaatcct
cgggatttcattgattacttcttgatcaaaatgaaacaggaaaaccacagtcagcagttg
gagttcactattgaaaacttgatagccactgcaagtgatttgtttggagctgggacaaag
accacaagcaccaccctaagatatnngctcttgaagcccccggaagtcacagctaaaatc
caggaagagattggccatgtaattggcagacaccggagcccctgcatgcaggacaggagc
cgcatgccctacatgaatgcagtgttgcatgagatccagaggtacattgaccttatccca
gtcaacctgccacatgcagtgacccgtgacattaaattcagaaactatgtcatccccaag
ggcacaaatgtactaatatcactgacttctgtgctacgtgatgacaaagaatttcccaac
ccagagacatttgaccctgcccatttcctggatgataatggcaactttaagaagagtgac
tacttcatggttttctcagcaggaaaacggatttgtgtgggagaaagcctggcccgtatg
gagctgtttttattcctgacctccattttacagaattttaccctgaaacctgtggttgac
ataaaggaccttgacaccaccccagttgccagtgggtttggacatatcccacccccctac
aagatttgctttgttcctttgtga

KEGG   Panthera tigris altaica (Amur tiger): 102958169
Entry
102958169         CDS       T02988                                 

Definition
(RefSeq) cytochrome P450 2C21-like
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00590  Arachidonic acid metabolism
ptg00591  Linoleic acid metabolism
ptg00830  Retinol metabolism
ptg01100  Metabolic pathways
ptg04726  Serotonergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102958169
   00590 Arachidonic acid metabolism
    102958169
   00591 Linoleic acid metabolism
    102958169
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102958169
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    102958169
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102958169
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102958169
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ptg00199]
    102958169
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     102958169
Cytochrome P450 [BR:ptg00199]
 Cytochrome P450, animal type
  CYP2 family
   102958169
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102958169
NCBI-ProteinID: XP_015392147
LinkDB
Position
Un
AA seq 513 aa
MISWNLVFIKPLDSKLPTAFTQGTTMDLFIILVIYLSCLILYFLWNRNRAKGKLPPGXPL
PIIGNILQINTNNVSKSISKLAESYGPVFTVYFGIKPTVVIYGYEAVKEALIDQSEVFSG
RGPFPVLDKSIQGLGIIFSNGEQWKQVRRFSLMVLRNMGMGKKSIEDRIQEEALYLVEAL
TKTNASPCDPTFLLGCASCNVICSVVFQNRFEYDDKKFSILINYFHENLLISSNSWIQLC
NAFPLLIHFPGCHNVLLKNIANQCRFIVEKIKEHQESLDLSNPRDFIDYFLIKIEKEKHN
KQSEFTMDNLIITVWDVISAGTETTSTTLRYGLLLLLKHPGVTAKVQEEIDRVVGRHRSP
CMQDRSRMPYTDAVVHEIQRFIDLVPNSLPHAVTQDTKFREYLIPKGTTILTSLTSVLHG
EKEFPNPDQFDPGHFLDESGNFKKSDYFLAFSAGKRVCIGEGLAHMELFLLLTNILQHFT
LKSVVDPKDLETAPVVNGVGAAPPVYKLCFIPV
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgatcagctggaacttagtatttataaaacctttggattccaagcttccaactgcattt
acgcaaggtacaacaatggatcttttcataattctggtgatttatctttcttgtttgatt
ctttattttctctggaatcgaaaccgtgccaaagggaagctaccacctggcnnccctctg
ccaatcattggaaatattttgcagataaatactaataatgtaagcaaatccataagcaag
ctagcagagagttacggccctgtgttcactgtgtactttggcatcaagcccactgtggtg
atatacggatatgaagcagtaaaggaagctctaattgatcagagtgaggtgttttctggc
agaggccctttcccagtgctggacaaatccatccagggattaggaattattttcagcaac
ggagagcagtggaagcaagttcggcgtttctccctcatggttttgcggaatatgggcatg
gggaagaagagtattgaagacagaattcaagaggaggccttgtatctggtggaagcatta
acaaaaaccaatgcatctccctgtgatcctactttccttctgggctgtgcttcctgcaat
gtgatctgctccgttgttttccagaatcgttttgagtatgatgataagaaattttcaatc
ttgataaactattttcatgaaaacctcctaatttcaagcaactcctggatacagctctgc
aatgcttttcctcttttaatacactttccaggatgtcacaatgtgttacttaaaaacatt
gctaaccaatgtaggtttattgttgaaaaaataaaagaacaccaagaatccctggacctc
agtaaccctcgagactttattgactacttcctgatcaaaatagaaaaggaaaaacacaat
aaacagtctgaatttaccatggacaacttgatcattactgtctgggatgtgattagtgca
ggaacagagacaacgagcaccaccctgaggtatggactcctgctcctgctgaagcaccca
ggggtcacagctaaagtccaggaagagattgaccgtgtggttggcagacaccggagcccc
tgcatgcaggacaggagccgcatgccttacacagatgctgtggtacatgagatccagaga
ttcattgacctcgtccccaacagtctgccccatgcagtgactcaggacactaagttcaga
gaatacctcattcctaagggcacaaccatattaacatctctgacttctgtcctgcatggt
gagaaagagtttcccaacccagatcagtttgatcctggccacttcctggatgaaagtggc
aactttaagaagagtgactacttcctggctttttcagcaggaaagagagtttgtattgga
gaaggcctggcccacatggagctgtttttactactgaccaacattttacagcattttaca
ttgaaatctgtggttgatccaaaggaccttgaaactgccccagttgtcaatggggtgggt
gctgcaccgcccgtatataagctgtgcttcattccagtctga

KEGG   Panthera tigris altaica (Amur tiger): 102966263
Entry
102966263         CDS       T02988                                 

Definition
(RefSeq) cytochrome P450 1A1
  KO
K07408  cytochrome P450 family 1 subfamily A1 [EC:1.14.14.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00380  Tryptophan metabolism
ptg00830  Retinol metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg01100  Metabolic pathways
ptg04913  Ovarian steroidogenesis
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102966263
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    102966263
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102966263
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102966263
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    102966263
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102966263
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ptg00199]
    102966263
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     102966263
Cytochrome P450 [BR:ptg00199]
 Cytochrome P450, animal type
  CYP1 family
   102966263
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102966263
NCBI-ProteinID: XP_007084655
LinkDB
Position
Un
AA seq 517 aa
MMLSVFGLSVPISATELLLASFVFCLVFWVVRAWQPRVPKGLKSPPGPWGWPLLGHVLTL
GKNPHLVLARLSQRYGDVLQIRIGSTPVLVLSGLDTIRQALVRQGDDFKGRPDLYSFSLI
SEGQSMTFSPDSGPVWAARRRLAQNALKSFSIASDPASSSSCYLEDHVSKEAEYLIGKFQ
ELMAKVGHFDPYRYVVVSVANVICAMCFGRRYDHDDQELLSLVNLSNEFGDGAASGNPVD
FFPILRYLPNPALDFFKDVNEKFSIFMHKMVKEHYKTFEKGHIRDITDSLIEHCQDKRLD
ENANIQLSDEKIVNVVSDLFGAGFDTVTTAISWCLMYLVTSPNVQEKIQKELDTVIGRAR
QPRLSDRLQLPYMEAFILEIFRHTSFIPFTIPHSTTKDTSLSGFYIPKERCVFVNQWQIN
HDQKLWGDPSEFRPERFLTPDGTINKALSEKVILFGLGKRKCIGETIARLEVFLFLAILL
QQVEFSVPQGTKVDMTPIYGLTMKHARCEHFQVRMRT
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgatgttgtctgtgtttggactctctgtccccatctcggccacagagcttctcctggcc
tcctttgtcttctgcctggtgttctgggtggtcagggcctggcagcctcgggttcccaaa
ggcctgaagagtccaccagggccctggggctggcctctgctcgggcacgtgctgaccttg
gggaagaacccacatctggtgctggcaaggctgagccagcgttacggggacgtgctgcaa
atccgcatcggctccacacccgtgctggtgctcagtggcctggacaccatccggcaggcc
ctggtgcgtcagggtgatgatttcaaggggcggcccgatctctacagcttcagtctgatc
tctgagggccaaagcatgaccttcagcccagactctggaccggtgtgggctgcccgcagg
cgcctggcccagaatgccctgaagagtttctccattgcttcagacccggcttcctcatcc
tcctgctacctggaagaccatgtgagcaaggaggctgagtacctcattggcaagttccag
gagctgatggcaaaggttgggcactttgacccctacagatatgtagtggtgtcagtggcc
aatgtcatctgcgccatgtgttttggccggcgctatgaccatgatgaccaagagctgctt
agcttagtcaacctgagtaatgagttcggggatggcgctgcctctgggaaccctgtggac
ttcttccccatccttcgatacctacctaaccctgccctggatttcttcaaggacgtgaat
gagaagttctccatcttcatgcataagatggtcaaggaacactacaaaacttttgagaag
ggtcacattcgggatatcacagacagcctgattgagcactgtcaggacaagaggctggac
gagaatgccaatatccagctgtctgacgagaagattgttaatgttgtctcggacctcttc
ggagctggatttgacacagtcacaactgccatctcctggtgcctcatgtacctggtgacg
agccccaatgtacaggaaaagatccagaaggagctggacacagtgattgggagggcgcgg
cagccccggctctctgacagactccagctgccctacatggaagcattcatcctggagatc
ttccgacatacctccttcatccctttcactatcccccatagtaccacaaaagacacaagt
ctgagtggcttttacatccccaaggagcgttgtgtctttgtgaaccagtggcagatcaac
catgaccagaagctatggggtgacccatctgagttccgaccagaacgatttctcactcct
gatggcaccatcaacaaggcactgagtgagaaggtgattctctttggtttgggcaagagg
aagtgcatcggtgagaccattgcccgcttggaggtctttctcttcctggccatcctgctg
cagcaggtggaattcagtgtgccacagggcacgaaggtggatatgacccctatttatggg
ctgaccatgaagcatgcccggtgtgagcacttccaagtgcggatgcgcacttag

KEGG   Panthera tigris altaica (Amur tiger): 102966939
Entry
102966939         CDS       T02988                                 

Definition
(RefSeq) cytochrome P450 1A2
  KO
K07409  cytochrome P450 family 1 subfamily A2 [EC:1.14.14.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00232  Caffeine metabolism
ptg00380  Tryptophan metabolism
ptg00591  Linoleic acid metabolism
ptg00830  Retinol metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102966939
   00591 Linoleic acid metabolism
    102966939
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    102966939
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102966939
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102966939
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102966939
   00982 Drug metabolism - cytochrome P450
    102966939
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102966939
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ptg00199]
    102966939
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     102966939
Cytochrome P450 [BR:ptg00199]
 Cytochrome P450, animal type
  CYP1 family
   102966939
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102966939
NCBI-ProteinID: XP_007084659
LinkDB
Position
Un
AA seq 512 aa
MAISPTATELLLASFAFCLVFWVVRAWQPRVPKGLKSPPGPWGWPLLGHVLTLGKNPHLV
LARLSQRYGDVLQIRIGSTPVLVLSGLDTIRQALVQQGDDFKGRPDLYSFRLVTDGHSIA
FSPDSGPVWAACKRLAQSALNTFSIASDPASASSCHLEDHVSKEAEALISRLQEQMAEVG
SFDPHSQVVLSVANVIGAMCFGQHFPQDSEEKLSLIHSSNTFVENASSGNPVDFFPIFQY
IPTPGLQRFKAFNQKLVQFLQKIIQEHYQDFDENNIQDITGALLKHCKKGSRANGGRIPH
EKIVSLINDIFGAGFDTVTTAISWSLMYLVTNPEKQRKIQEELDTVVGRARRPRLSDRLQ
LPYLEASILEIFRHSSFIPFTVPHSTTRDTTLNGFYIPEKHLVFINQWQVNHDQKVWGDP
FEFRPERFLTADGTAINKILSEKVMIFGLGKRRCIGEVLAKWEVFLFLAILLQQLEFSVP
AGVKVDLTPIYGLTMKHVRCEHVQARPRFSIK
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcaatatccccaacggccacagagcttctcctggcctcctttgccttctgcctggtg
ttctgggtggtcagggcctggcagcctcgggttcccaaaggcctgaagagtccaccaggg
ccctggggctggcctctgctcgggcacgtgctgaccttggggaagaacccacatctggtg
ctggcaaggctgagccagcgttacggggacgtgctgcaaatccgcatcggctccacaccc
gtgctggtgctcagtggcctggacaccatccggcaggccctggtgcagcagggtgatgac
ttcaagggccggcccgacctctacagcttcaggctggtcactgatggccacagcatagcc
ttcagcccagactctggaccggtgtgggccgcctgcaagcgcctggcccagagcgctctc
aacaccttctccattgcctcagacccggcttccgcatcctcctgccatctggaagaccat
gtgagcaaggaggccgaggccctcatcagcaggttgcaggaacagatggcagaggtcggg
agcttcgatccccatagccaagtggtgctgtcagtggccaatgtcattggtgccatgtgc
tttgggcagcactttcctcaggacagtgaggaaaagctcagcctcatacacagcagcaat
acattcgtggagaatgcgtcctctgggaaccctgtggacttcttccccatctttcaatat
atccccacccctggcctgcagagattcaaggccttcaaccagaagttggtacagttcctg
cagaaaattatccaggagcactaccaggactttgacgagaacaacatccaggacatcaca
ggcgccctgttgaagcactgtaagaagggctccagagctaatggtggccgcatccctcac
gagaagattgtcagccttatcaacgacatttttggggccggatttgacactgtcacaaca
gccatctcctggagccttatgtaccttgtgacaaatcctgagaaacagagaaagatccag
gaggagctggacacagtggttggcagggcacggcggccccggttgtctgacagactccag
ctgccctacctggaggcctccatcttggagatcttccgacactcctccttcatccccttc
actgtcccccacagcacaacaagggacacgacactgaatggcttctacatcccagagaaa
caccttgtcttcataaaccagtggcaggtcaatcatgaccaaaaggtgtggggagatcca
tttgagttccggccagagcgattcctcactgctgatggcactgccatcaacaagatctta
agcgagaaggtgatgatctttggcctgggcaagcgccggtgtataggggaggtcctggcc
aagtgggaggtcttcctcttcctagccatcttgctgcagcagctggagttcagcgtgcca
gcgggtgtgaaagtagacctaactcccatctatggactgaccatgaagcacgtccgctgt
gagcacgtccaggcccggccacgtttctccatcaagtga

KEGG   Panthera tigris altaica (Amur tiger): 102969051
Entry
102969051         CDS       T02988                                 

Definition
(RefSeq) cytochrome P450 2E1
  KO
K07415  cytochrome P450 family 2 subfamily E1 [EC:1.14.14.-]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00590  Arachidonic acid metabolism
ptg00591  Linoleic acid metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg04932  Non-alcoholic fatty liver disease
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102969051
   00590 Arachidonic acid metabolism
    102969051
   00591 Linoleic acid metabolism
    102969051
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102969051
   00982 Drug metabolism - cytochrome P450
    102969051
   00983 Drug metabolism - other enzymes
    102969051
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102969051
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102969051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ptg00199]
    102969051
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     102969051
Cytochrome P450 [BR:ptg00199]
 Cytochrome P450, animal type
  CYP2 family
   102969051
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102969051
NCBI-ProteinID: XP_007079775
LinkDB
Position
Un
AA seq 495 aa
MAALGITVALLVWMATLMLISVWKQIYSSWKLPPGPFPLPIIGNLLQLDFKNVPKSLTKL
AERYGPVFTLYLGSQRTVVLHGYKAVKEVLLDYKNEFSGRGEIYAFAAHKEKGITFNNGP
SWKDTRRLSLSILRDYGMGKLANEERIQREVPFLTEAFRKTQGQPFDPTFVLGYAPCNVI
SDILFHKRFDYTDQTGLRIQKLFNENFHLLSTSWLQLYNIFPSYMRYLPGNHRKVIKNVY
EIKSYTAARVKEHEESLDPNCPRDFTDSLLLEMRKERYTKEPWFTFDNIAATIADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRLEMPYMDAVVHEIQRF
IDLLPSNLPHEAIQDTMFRGYVIPKGTVVVPTLDSLLFDNQEFPDPEKFMPEHFLNESGK
FKYSDYFKVFSAGKRVCVGEGLARMELFLFLSAILQHFNLKPLVDPKDIDLSPSTIGFAK
IPPRYKLCVIPRSGV
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggctgccctgggcatcacagttgccctgttggtgtggatggccaccctaatgcttatc
tctgtctggaagcagatctacagcagctggaaactaccccctggccctttcccactgccc
attattgggaatcttctccagttggatttcaagaatgttcccaaatctttaaccaagttg
gcagagcggtacgggcctgtgttcaccttgtacctgggctcccagcgcaccgtggttctg
catggctataaggcagtgaaggaagtcctgctcgactacaagaatgaattttctggcaga
ggagaaatctatgcctttgcggcacacaaggaaaaaggaattacgttcaacaatgggccg
agctggaaggacacccggcgcctgtctctgagcatcctccgggactatggcatggggaag
cttgccaatgaggagcggatccagagggaggtgcccttcctgacggaggcattccggaag
acccagggacagcccttcgaccccacctttgttctgggctacgccccctgcaacgtcatc
tcggacatcctcttccacaagcgctttgactacacggaccaaaccgggctgaggatacag
aagctgttcaacgagaacttccacctgctcagcaccagctggctccaattatataacatt
ttcccaagctatatgcgctacctgcctggaaaccatagaaaagtaataaaaaatgtgtat
gaaataaaaagttatactgcagcaagagtgaaggagcacgaggagtcgctggaccccaac
tgcccccgggacttcactgacagcctgctcctggagatgcggaaggaaagatacaccaaa
gagccttggttcacctttgacaacattgctgccaccatagctgacctgttttttgcgggt
acagagaccaccagcaccactctgagatatgggctcctgattctcatgaaatacccagag
atcgaagagaaactgcatgaagaaatcgacagggtgattgggccaagccgaatccctgcc
atcaaggaccggttagagatgccttatatggatgccgtggtgcatgagattcagcgattc
atcgacctcttgccctccaacctgccccatgaagcaatccaggacacaatgttcagagga
tacgtcatccccaagggtacagtcgtggtcccaacgctggactccctcttgtttgacaac
caagagttccctgatccagagaagtttatgccagagcactttctgaatgaaagtggaaag
ttcaaatatagtgattatttcaaggtattttctgcaggaaagcgggtgtgtgttggagaa
ggcctggctcgcatggagttgttcctgttcttgtccgccattttgcagcactttaacctg
aagcctctcgttgaccccaaggatatcgatctcagtcccagcacaattgggtttgccaaa
atcccaccccgttacaagctctgtgtcattccccgttcgggtgtgtga

DBGET integrated database retrieval system