KEGG   Panthera tigris altaica (Amur tiger): 102957957
Entry
102957957         CDS       T02988                                 

Gene name
GZMB
Definition
(RefSeq) granzyme B
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04210  Apoptosis
ptg04650  Natural killer cell mediated cytotoxicity
ptg04940  Type I diabetes mellitus
ptg05202  Transcriptional misregulation in cancer
ptg05320  Autoimmune thyroid disease
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102957957 (GZMB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102957957 (GZMB)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102957957 (GZMB)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102957957 (GZMB)
   05330 Allograft rejection
    102957957 (GZMB)
   05332 Graft-versus-host disease
    102957957 (GZMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102957957 (GZMB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102957957 (GZMB)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     102957957 (GZMB)
Peptidases and inhibitors [BR:ptg01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102957957 (GZMB)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 102957957
NCBI-ProteinID: XP_007098167
LinkDB
Position
Un
AA seq 255 aa
MQPLLLLLAFFLPSRAKAGEIIGGHEAKPHSRPYMAYLWIQNREVCSKCGGFLIQEKFVL
TAAHCWGSSINVTLGAHNIKKQEKTQQIIPVRRAIPHPDYNPKNYSNDIILLQLVKKAKL
TAAVRPLGLPKGKDRVRPGQVCRVAGWGQMATGRYPDTLQEVELIMQEDQECKSRFPNYY
NHKTQLCVGDPKEKKSSFQGDSGGPLLCNNVAQGIVSYGPKDGAPPRAYTKVTSFLPWIK
KTMRGLFLQEPDYLL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcagcctctcctgctcctgctggcctttttcctgccttctagggcaaaggcaggggag
atcatcgggggacatgaggccaagccccactcccggccctacatggcatatctgtggatc
cagaatagggaggtgtgcagtaagtgtggtgggttcctgatacaagagaagttcgtgctg
acagccgctcactgctggggaagctccatcaacgtcaccctgggggcccacaacatcaag
aagcaggagaagacccagcagatcatccccgtgagaagagccatcccccacccagactat
aatccaaagaactactccaacgacatcatcttactgcagctggtgaaaaaggccaagctg
actgcagctgtgaggcccctgggcctgcccaaaggcaaggacagggtgaggccaggacag
gtgtgcagagtggccggctggggacagatggccacgggaagatacccagacacactgcag
gaggtagagctgatcatgcaggaggatcaggagtgcaaatcccgcttccccaattattac
aaccacaaaactcagctctgtgtgggagacccaaaggaaaagaagtcttcctttcagggg
gactctgggggccctctcctgtgtaacaatgtggctcagggcatcgtctcctatggacca
aaagatggggcacctccacgggcctacactaaagtcacaagtttcctgccctggataaag
aaaacgatgagaggcctcttcctgcaggaaccagactatttgctctga

KEGG   Panthera tigris altaica (Amur tiger): 102967670
Entry
102967670         CDS       T02988                                 

Definition
(RefSeq) mast cell protease 1A-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04210  Apoptosis
ptg04650  Natural killer cell mediated cytotoxicity
ptg04940  Type I diabetes mellitus
ptg05202  Transcriptional misregulation in cancer
ptg05320  Autoimmune thyroid disease
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102967670
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102967670
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102967670
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102967670
   05330 Allograft rejection
    102967670
   05332 Graft-versus-host disease
    102967670
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102967670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102967670
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     102967670
Peptidases and inhibitors [BR:ptg01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102967670
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 102967670
NCBI-ProteinID: XP_007098127
LinkDB
Position
Un
AA seq 292 aa
MQPLLLLLTFLLASKAEAGKIIGGHEANPHSRPYMAFLRIYKPDNTCKQCGGFLVREDFV
LTAAHCWGSLMTVTLGAHNIKRKERTQQIIPVREIIRPSGYTSETFLNDIMLLQLSRKAR
LDANVRPIRLPKRNVWVRPGMVCSVAGWGQFRMDSSSGAEKLHEVELEIQKDEQCMSHYN
HLYNPATQMCVGNPRRKKSALQGDSGGPLVCDNVAQGIVSCVKHCGTPPLVYTRISGYMH
WIEKIMRHFSPPGPDSDASRINPSTFSGAEARTALSKGGGEEAARDLINFHL
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcagccgctcctgctcttgctgacctttcttctggcctccaaggctgaagcggggaaa
ataatcgggggccatgaagccaaccctcattctcgtccctacatggcatttctccggatc
tacaaaccagacaacacctgcaaacagtgcgggggtttccttgtacgtgaggattttgtg
ctaacagcagctcactgctggggaagcctcatgactgtgacactgggggcccacaacatc
aagaggaaggagaggacccagcagatcatccccgtgagagaaatcatccgcccctcaggc
tacacttctgaaaccttcctcaatgacatcatgttactgcagctgtcaagaaaggcccgc
ctggatgccaacgtgaggcccatcaggctgcccaaaaggaatgtgtgggtgaggccaggg
atggtgtgcagtgtggccggctggggacaattcagaatggacagctcctccggggcagag
aaactgcatgaggtagagcttgaaatccagaaggatgagcaatgcatgtcacactacaat
cacctgtataaccccgccacccagatgtgtgtggggaacccaagaaggaagaagtctgcc
cttcagggagactccggaggcccccttgtgtgcgacaacgtggcccagggcattgtctcc
tgtgtaaaacactgtgggacacctccacttgtctacaccaggatttcaggctatatgcac
tggatagaaaaaataatgagacacttcagcccaccaggaccagactcagacgcctccagg
atcaatccatccaccttctctggggcagaggccagaactgcactcagcaaagggggtgga
gaggaggccgccagggacctaataaacttccatctctag

DBGET integrated database retrieval system