KEGG   Panthera tigris altaica (Amur tiger): 102957987
Entry
102957987         CDS       T02988                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04217  Necroptosis
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04630  JAK-STAT signaling pathway
ptg04659  Th17 cell differentiation
ptg04917  Prolactin signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04931  Insulin resistance
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg05145  Toxoplasmosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05169  Epstein-Barr virus infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05212  Pancreatic cancer
ptg05221  Acute myeloid leukemia
ptg05223  Non-small cell lung cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102957987 (STAT3)
   04066 HIF-1 signaling pathway
    102957987 (STAT3)
   04068 FoxO signaling pathway
    102957987 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102957987 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102957987 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102957987 (STAT3)
   04062 Chemokine signaling pathway
    102957987 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102957987 (STAT3)
   04917 Prolactin signaling pathway
    102957987 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    102957987 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102957987 (STAT3)
   05206 MicroRNAs in cancer
    102957987 (STAT3)
   05205 Proteoglycans in cancer
    102957987 (STAT3)
   05203 Viral carcinogenesis
    102957987 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102957987 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102957987 (STAT3)
   05221 Acute myeloid leukemia
    102957987 (STAT3)
   05223 Non-small cell lung cancer
    102957987 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102957987 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102957987 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102957987 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    102957987 (STAT3)
   05161 Hepatitis B
    102957987 (STAT3)
   05160 Hepatitis C
    102957987 (STAT3)
   05163 Human cytomegalovirus infection
    102957987 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102957987 (STAT3)
   05169 Epstein-Barr virus infection
    102957987 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102957987 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102957987 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102957987 (STAT3)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102957987 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 102957987
NCBI-ProteinID: XP_007087724
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacacacggtacctggagcagcttcatcag
ctgtacagtgacagcttcccaatggagctgcggcagtttctggccccttggattgagagt
caagattgggcatatgcggccagcaaagaatcacatgctactttggtgtttcataatctc
ttgggtgagatcgaccagcagtacagccgtttcctacaggaatcgaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcaggtatctggagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctgctccagactgcggcc
actgcagcccagcaagggggccaggccaaccaccccacggccgccgtggtgacggagaag
cagcagatgctggagcagcacctgcaagatgttcggaagcgagtacaggacctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgacttcaactataaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtccgtgaccaggcagaagatg
cagcagctggaacagatgctcacggcgctggaccagatgcggcgcagcatcgtgagtgag
ttggcggggctgttgtcagccatggagtatgtgcagaagacgctcacggacgaagagctg
gctgactggaagaggcggcagcagattgcgtgcatcgggggcccgcccaacatctgcctc
gaccgcctagaaaactggataacctcgttagcggaatctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcaaaaagtgtcctacaaaggggatcccattgtacag
caccggccaatgctggaggagaggattgtggagctgtttcgaaacttaatgaaaagtgcc
tttgtggttgagcggcagccctgcatgcccatgcatcccgaccggccattggtcatcaag
actggcgtccagttcactaccaaagtcagattgctggtcaaattccctgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggatgttgcggctctcagagga
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtccaac
aacggcagcctctctgcagaattcaaacatctgaccctgagagagcaaagatgtggtaac
gggggccgagccaattgtgatgcctccctgattgtcaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccagggcctcaagattgaccttgagacccactccttgccg
gttgtggtgatctccaacatctgtcagatgcctaatgcctgggcgtctatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaagcccccgattggaacc
tgggatcaagtggctgaggtgctgagctggcagttctcctccaccacaaagcgaggcctg
agcatcgagcagttgacgacgctggcagagaagctcttaggacctggtgtgaactattca
gggtgtcagattacgtgggctaaattttgcaaagaaaacatggccggcaaaggcttctcc
ttctgggtctggctagacaatatcattgatcttgtgaaaaagtacatcctggctctttgg
aatgaagggtacataatgggttttatcagtaaggagcgggagcgggccatcttgagcacc
aagcccccaggcaccttcctgctaagattcagtgaaagcagcaaagaaggaggtgtcacc
ttcacttgggtggagaaggacatcagcggcaagacccagatccagtccgtggaaccatat
accaagcagcagctgaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgctaccaacatcctcgtgtctccgctggtttatctctacccggacattcctaaggag
gaggcgtttggaaagtattgtcgaccagaaagccaggagcaccctgaagctgacccaggt
agtgctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgaaccctcagcaggagggcagtttgaatccctcacgttcgacatggag
ttgacctcggagtgcgccacctccccaatgtga

DBGET integrated database retrieval system