KEGG   Panthera tigris altaica (Amur tiger): 102958013
Entry
102958013         CDS       T02988                                 

Gene name
UPB1
Definition
(RefSeq) beta-ureidopropionase 1
  KO
K01431  beta-ureidopropionase [EC:3.5.1.6]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00410  beta-Alanine metabolism
ptg00770  Pantothenate and CoA biosynthesis
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102958013 (UPB1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102958013 (UPB1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    102958013 (UPB1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102958013 (UPB1)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     102958013 (UPB1)
SSDB
Motif
Pfam: CN_hydrolase Tugs
Other DBs
NCBI-GeneID: 102958013
NCBI-ProteinID: XP_007092367
LinkDB
Position
Un
AA seq 384 aa
MEGSEWESLEQCLEKHLPPADLREVKRILYGKETRKLDLPGRAFEAASEGDFELQGYAFE
AAKEQLRPPRTMRVGLVQNRTPLPADAPVAKQVTALHRRIEAIAEVAAMCGVNIICFQEA
WTMPFAFCTREKLPWTEFAESAEDGPTTRFCQKLAKKHDMVVVSPILERDREHGDILWNT
AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPL
NWLMYSINGAEIIFNPSATIGALSESLWPIEARNAAIANHCFTCAINRVGQEHFPNEFTS
GDGKKAHQDFGYFYGSSYVAGPDSSRTPGLSRNRDGLLVAELDLNLCRQVNDIWNFKMTG
RYEMYARELAEAIKPNYSPNIVKE
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggaggggtctgaatgggagtcgctggagcagtgcttggagaagcacctgccacccgca
gacttgagggaggtgaaacgcattctctatggcaaggaaaccaggaagctcgatctgccc
ggcagggcttttgaagctgcctctgaaggggactttgagctgcaaggatatgcctttgag
gcagcaaaggagcaactgaggccacctcggaccatgcgtgtgggacttgttcagaacaga
actcccctgcctgccgatgcccctgtggcaaaacaggtcactgcccttcacagacgcata
gaagccattgcagaggtggctgcaatgtgtggagtgaacatcatctgtttccaggaagca
tggactatgccctttgctttctgtacgagagagaagctcccttggacggaatttgctgag
tcagcagaggatggacccaccaccagattctgtcagaagctggcaaagaagcatgacatg
gtggtggtatcccccatcctggaacgagacagagagcatggggacattttgtggaacaca
gctgtggtgatctccaattctggagctgtcctgggaaagaccaggaaaaaccacatcccc
agagtgggtgacttcaatgagtcaacttactacatggagggaaacctcggacaccccgtg
ttccagactcagttcgggaggattgcggtgaacatttgctacgggcggcaccaccctctc
aactggctcatgtacagcatcaacggggctgagatcatcttcaacccctcagccaccatc
ggagcactcagtgagtccctgtggccaatcgaggccagaaacgcagccattgcaaatcac
tgcttcacctgtgctatcaaccgtgtgggccaggagcacttcccgaatgaatttacctct
ggagatgggaagaaagctcaccaggacttcggctacttttatggctcgagctacgtggca
ggcccggacagcagccgcacccctggtctctcccgcaatcgggacgggctgctggttgct
gagcttgacctgaacctctgccggcaggtgaatgacatctggaacttcaagatgacgggc
agatatgagatgtacgctcgggaacttgccgaagccatcaaacccaactacagccccaat
attgtgaaagagtag

DBGET integrated database retrieval system