KEGG   Panthera tigris altaica (Amur tiger): 102958413
Entry
102958413         CDS       T02988                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04068  FoxO signaling pathway
ptg04144  Endocytosis
ptg04218  Cellular senescence
ptg04350  TGF-beta signaling pathway
ptg04380  Osteoclast differentiation
ptg04390  Hippo signaling pathway
ptg04520  Adherens junction
ptg04659  Th17 cell differentiation
ptg04926  Relaxin signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05142  Chagas disease
ptg05161  Hepatitis B
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05220  Chronic myeloid leukemia
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102958413 (TGFBR2)
   04350 TGF-beta signaling pathway
    102958413 (TGFBR2)
   04390 Hippo signaling pathway
    102958413 (TGFBR2)
   04068 FoxO signaling pathway
    102958413 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102958413 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102958413 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    102958413 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102958413 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102958413 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102958413 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102958413 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102958413 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    102958413 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102958413 (TGFBR2)
   05212 Pancreatic cancer
    102958413 (TGFBR2)
   05225 Hepatocellular carcinoma
    102958413 (TGFBR2)
   05226 Gastric cancer
    102958413 (TGFBR2)
   05220 Chronic myeloid leukemia
    102958413 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102958413 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102958413 (TGFBR2)
   05161 Hepatitis B
    102958413 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102958413 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102958413 (TGFBR2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102958413 (TGFBR2)
Protein kinases [BR:ptg01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102958413 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102958413
NCBI-ProteinID: XP_007075153
LinkDB
Position
Un
AA seq 670 aa
MAAVCQMVASVSDSEMPTAIKNLLSENKSFNSGPICLPPQHVNQWHQQNLGTVSVSTCNA
QFNEYLARLQGPALQSNINPGVAVEDSGAWSLANFGDSISETVSVGRLTDFLQGNGEKLE
PVSCKERPCSSSHAVNDGMMVTDNKGVIKFPQLCKFCDVRSSTCDSQKSCLSNCSITSIC
ERPHEVCLAVWRKNDENITLETLCHDPKVTYHGIALEDSASPKCIMKEKKVLGETFFMCS
CSTDECNDYIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKL
SPSWETSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAE
VYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTEL
GKQYWLITAFHAKGNLQEYLTRHVISWEDLRTLGSSLARGIAHLHSDHTLCGRPKMPIVH
RDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLE
NVESFKQTDVYSMALVLWEMTSRCNAVGEVKEYEPPFGSKVREHPCVESMKDNVLRDRGR
PEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSDLQHLDRLSGRSCSEEKI
PEDGSLNTTK
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcggctgtctgccagatggtcgcctcagtgtctgactccgaaatgccaactgcaatt
aaaaaccttctttcagagaacaagtctttcaattctgggcccatatgtcttcctcctcaa
cacgtgaaccagtggcatcagcagaatctgggaacggtctccgtttctacctgtaatgct
cagtttaatgagtacttggctaggttacagggcccagctctgcaatcaaacattaacccg
ggtgttgctgtggaggactccggcgcctggagccttgccaattttggggattctatctca
gagacagtcagtgttggtcgattaactgatttccttcaaggcaatggggagaagttagaa
ccagtctcttgcaaagaacgcccttgtagctcttcccatgcagttaacgatggcatgatg
gtcaccgacaacaagggtgtcatcaagtttccgcagttgtgcaaattttgtgatgtgaga
tcttccacctgtgacagccagaaatcctgcctcagcaactgcagcatcacgtctatctgc
gagaggccacacgaagtctgtctggccgtctggagaaagaacgatgagaacataacccta
gagacgctttgccatgaccccaaggttacctaccatggaattgctctcgaagactctgct
tctcccaagtgtattatgaaggaaaaaaaggtgttgggcgagacgttctttatgtgttcc
tgcagcaccgatgaatgcaatgactacatcatcttctcagaagaatacgccaccaacaac
cctgacctgttgttggtcatattccaagtgacaggcgtcagcctcctgcccccgctgggg
atcgccatagccgtcatcatcatcttctactgctaccgtgttcaccggcagcagaagctg
agcccatcctgggagaccagcaagccgcgaaagctcatggagttcagcgagcacctcgcc
atcatcctggaagacgaccgctctgacatcagctctacctgcgccaacaacatcaaccac
aacacagagctgctgcccattgagctggacaccctggtggggaaaggccgcttcgccgag
gtctacaaggccaagctgaagcagaacacttctgaacagttcgagaccgtggcggtcaag
atcttcccttacgaggagtacgcctcctggaagacggagaaggacattttctcagacatc
aacctgaagcacgagaacatactgcagttcctgacagccgaggagcgcaagacggagctg
gggaagcagtactggctgatcacggccttccacgccaagggcaacctgcaggagtacctg
acgcggcacgtcatcagctgggaggacctgcgcacgctgggcagctccctcgcccggggc
attgcccacctgcacagcgaccacaccctgtgcgggaggcccaagatgcccatcgtgcac
agggacctcaagagctccaatatcctcgtcaagaacgatctgacctgctgcctgtgtgac
tttgggctttccctgcgtctggacccgaccctgtctgtggatgacctggccaacagcggg
caggtgggaactgcaagatacatggctccagaagtcctagagtccaggatgaatttggag
aatgttgaatcctttaagcagacggatgtctactccatggctctggtcctctgggagatg
acatctcgctgtaatgcggtgggagaggtgaaagagtacgagcctccatttggttccaag
gtgcgggagcatccctgtgttgagagcatgaaggacaatgtgctgagagaccgaggacga
ccagaaattcccagctcctggctcaaccaccagggcatccagatggtgtgcgagactctg
accgagtgctgggaccatgacccggaggcccggctcacggcccagtgcgtggcggagcgc
ttcagtgacctgcagcacctggacaggctctcggggaggagctgctccgaggagaagatt
cccgaagatggctcgttgaacactaccaaatag

DBGET integrated database retrieval system