KEGG   Panthera tigris altaica (Amur tiger): 102958442
Entry
102958442         CDS       T02988                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04010  MAPK signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04115  p53 signaling pathway
ptg04210  Apoptosis
ptg04217  Necroptosis
ptg04650  Natural killer cell mediated cytotoxicity
ptg04668  TNF signaling pathway
ptg04932  Non-alcoholic fatty liver disease
ptg04940  Type I diabetes mellitus
ptg05010  Alzheimer disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05320  Autoimmune thyroid disease
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102958442 (FAS)
   04668 TNF signaling pathway
    102958442 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102958442 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102958442 (FAS)
   04217 Necroptosis
    102958442 (FAS)
   04115 p53 signaling pathway
    102958442 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102958442 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102958442 (FAS)
   05205 Proteoglycans in cancer
    102958442 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102958442 (FAS)
   05330 Allograft rejection
    102958442 (FAS)
   05332 Graft-versus-host disease
    102958442 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102958442 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102958442 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102958442 (FAS)
   04932 Non-alcoholic fatty liver disease
    102958442 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102958442 (FAS)
   05161 Hepatitis B
    102958442 (FAS)
   05160 Hepatitis C
    102958442 (FAS)
   05164 Influenza A
    102958442 (FAS)
   05162 Measles
    102958442 (FAS)
   05168 Herpes simplex virus 1 infection
    102958442 (FAS)
   05163 Human cytomegalovirus infection
    102958442 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102958442 (FAS)
   05169 Epstein-Barr virus infection
    102958442 (FAS)
   05165 Human papillomavirus infection
    102958442 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102958442 (FAS)
   05143 African trypanosomiasis
    102958442 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102958442 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102958442 (FAS)
   04090 CD molecules [BR:ptg04090]
    102958442 (FAS)
Cytokine receptors [BR:ptg04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102958442 (FAS)
CD molecules [BR:ptg04090]
 Proteins
  102958442 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 Stn1_C
Other DBs
NCBI-GeneID: 102958442
NCBI-ProteinID: XP_015391744
LinkDB
Position
Un
AA seq 331 aa
MSKCFRHPCLPRCLVDKSVFAHAFLFQILTSVAGSLFRGDSAQVADVNSKVLKLSKNATE
GEPGCKEGLHRGSKFCCLPCSPGTRKAADCEEDGGTASCIPCEEGKDYTDTSHFSPRCRR
CRICDGEHGLEVEKACTRTQDTKCRCKSNFFCNVSLCEHCNPCMMCEHGILENCTPTSNT
KCKQGSSSKLLWLCALLLILPSALVCCCVLKKYRNTKNGRRRSTVSSTESIPMNFADIDL
SKYISSIAEQMKITQVREFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQLHGRKG
AYYALMKGLRKANLCALAEKIEDMVQKDSAG
NT seq 996 nt   +upstreamnt  +downstreamnt
atgtccaaatgcttccgtcacccctgtttaccacgttgcctggttgacaagtcagtgttt
gctcatgctttcctttttcagatacttacctctgttgccggatcactgttcagaggcgac
agtgctcaggtcgccgatgtcaactccaaggtgttgaaattgagtaagaacgctaccgaa
ggggagcctggatgcaaggaaggtctgcatcgtgggagcaagttctgctgtctgccatgc
tctcctggcacacgaaaagctgccgactgtgaagaagatgggggtacagcatcctgtata
ccctgtgaagaagggaaggactacacagacacgagccatttttctcccagatgcagaaga
tgtagaatttgtgatggagagcacggcttagaagtggaaaaagcctgtacccggacccag
gataccaagtgcagatgtaaatcaaactttttttgtaacgtctctctgtgtgaacactgt
aacccgtgcatgatgtgtgaacatggaatccttgagaattgcacaccaaccagcaacacc
aaatgtaaacaaggatccagctccaaacttctgtggctttgtgccctgctcctgattctg
ccgtccgcactagtatgttgctgtgtgttgaaaaagtacaggaatacaaagaatggccgc
cggagatctacagtctcatctactgagagtatcccaatgaatttcgcagacatcgacttg
agtaaatacatcagtagcattgccgaacaaatgaaaataactcaggtcagagaatttgtc
cgcaagaacggtatcaacgaagccaaaatagacgagatcaagaacgacaacctccaagac
acagctgaacagaaagtccaactgctccggaattggtaccagctccatgggaggaagggc
gcatattacgctctgatgaaaggcctcaggaaagccaatctctgcgctcttgccgagaaa
attgaagatatggtccagaaggacagtgcgggctaa

DBGET integrated database retrieval system