KEGG   Panthera tigris altaica (Amur tiger): 102958522Help
Entry
102958522         CDS       T02988                                 

Gene name
POLE2
Definition
(RefSeq) DNA polymerase epsilon 2, accessory subunit
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg03030  DNA replication
ptg03410  Base excision repair
ptg03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102958522 (POLE2)
   03410 Base excision repair
    102958522 (POLE2)
   03420 Nucleotide excision repair
    102958522 (POLE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ptg03032]
    102958522 (POLE2)
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102958522 (POLE2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     102958522 (POLE2)
DNA replication proteins [BR:ptg03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    102958522 (POLE2)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      102958522 (POLE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_E_B Dpoe2NT
Motif
Other DBs
NCBI-GeneID: 102958522
NCBI-ProteinID: XP_007097610
LinkDB All DBs
Position
Un
AA seq 518 aa AA seqDB search
MRVCSYQPTVLRKFEAVKYLTEALTPISEIELEDALEKIIDAVEKQPLSSNMIERSVVEA
AVQECSQSVDETMEHIFNIIGAFDIPRFVYSSERKKFLPLLMTNHPAPNLFGTARDKAEL
FRERYTILHQRTHRHELFTPPVIGSHPDETGSKFQLKTVETLLGSTTKIGDVIVLGMITQ
LKEGKFFLEDPTGTVQLDISKAQFHSGLYTESCFVLAEGWFEDQVFHVNAFGFPPTEPSS
TTRAYYGNINFFGGPSNTSVKTSAKLKQLEEENKDAMFVFISDVWLDQGEVLGKLHTMFS
GYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKTLADIICEYPNIHQSSRFVFVPGPED
PGFGSILPRPPLAESITDEFRQRVPFSIFTTNPCRIQYCTQEIIVFREDLVNKMCRNCVR
FPSSNLDIPNHFVKTILSQGHLTPLPLYVCPVYWAYDYALRVYPVPDLLVIADKYDPFTV
TNTECLCMNPGSFPRSGFSFKVFYPSSKIVEDSKLQGF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtctgtagttatcaacctacagttttgagaaaatttgaagctgttaagtacctc
acagaagctcttacacctatcagtgaaatagaacttgaagatgcgctggaaaagatcatt
gatgcagttgaaaagcaacccttgtcatcaaacatgattgaacgatctgtagtggaagca
gcagtccaggaatgcagtcagtctgtagatgaaactatggaacatattttcaatatcata
ggagcatttgatattccacgctttgtgtacagttcagaaagaaaaaaatttcttcctcta
ttaatgaccaaccatcctgcaccaaatttatttgggacagcaagagataaagcagagctg
tttcgtgaacgatatactattttgcaccagaggacacacagacatgaattattcactcct
ccagtgataggttctcatcctgatgaaaccggaagcaaattccagcttaaaacggtagaa
accctattgggcagtacaaccaaaattggagatgtgattgttcttggaatgataacccag
ttaaaagagggaaaattttttctggaagatcctacgggaaccgtacaactggatattagt
aaagctcagttccatagtggtttatacacagagtcatgctttgtcttagcagaaggctgg
tttgaagatcaggtgtttcatgtcaatgccttcggatttccacccactgaaccctctagt
actactagggcatactatggaaatattaatttttttggagggccttctaatacatctgtg
aagacttctgcaaaactaaaacaactagaagaagagaataaagatgcaatgtttgtgttt
atatctgacgtttggttagaccaaggagaagtgttgggaaaacttcacaccatgttttct
ggttattcaccagcacctccaacctgctttattctgtgtggtaatttttcatctgcacca
tatggaaaaaatcaagttcaagctttgaaagattccttaaaaactttggcagacataata
tgtgaatatccaaatatccaccaaagtagtcgatttgtgtttgttcctggtccagaggat
cctggatttggttccatcttaccaaggccaccacttgctgaaagcatcactgatgaattc
agacaaagagtaccattttcaatttttactaccaatccttgcagaattcagtactgtaca
caagaaattattgtcttccgtgaggacttagtgaataaaatgtgcagaaactgtgtccgc
ttccctagtagcaatttggatattcctaatcattttgtaaagacgatcttatcccaagga
cacctgacccctctccccctctatgtctgcccagtgtactgggcatatgactatgctctg
agagtgtaccctgtgcctgatctcctggtcattgcagacaaatacgatcctttcactgtg
accaatacagaatgcctctgtatgaacccgggatcttttccaagaagtggattttcattc
aaagttttttatccatccagtaagatagtagaagacagcaaacttcaaggtttctga

DBGET integrated database retrieval system