KEGG   Panthera tigris altaica (Amur tiger): 102958578Help
Entry
102958578         CDS       T02988                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg03030  DNA replication
ptg03410  Base excision repair
ptg03420  Nucleotide excision repair
ptg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102958578 (LIG1)
   03410 Base excision repair
    102958578 (LIG1)
   03420 Nucleotide excision repair
    102958578 (LIG1)
   03430 Mismatch repair
    102958578 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ptg03032]
    102958578 (LIG1)
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102958578 (LIG1)
Enzymes [BR:ptg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102958578 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102958578 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102958578 (LIG1)
DNA replication proteins [BR:ptg03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102958578 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102958578 (LIG1)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102958578 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     102958578 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     102958578 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 102958578
NCBI-ProteinID: XP_015395147
LinkDB All DBs
Position
Un
AA seq 934 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKETSSREIEPPPKVALKERNGEVPENDSPVKRPGRKAAR
VLGSEGEEEDEALTPSKGQKPAPGSPQVSPPSPVTFPEGSPPLSNTSPAGLSPTGIPKRR
TARKQLPKRPIQDILEEQNEDEDREAKRKKEEAETPTESLTEPELAQKEEAEGDRPTTPA
EHLETSPAEPPTDSTSEPEVAGKQEAREGDQAKPPPRAPKTVSSFFAPRKPATKKEGKEE
GPGTPRKEEAKGPLDPPGYNPAKNNYHPVDDACWKPGQKVPYLAVARTFEKIEEVSARLR
MVETLSNLLRSVVALSPPDLLPILYLSLNRLGPPQQGLELGVGDGVLLKAVAQATGKQGV
WWPLEHTHWPAWPQSTAKKIDVIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALA
QAVSLTPPRPGEAPRLSPPGCRSSGRTPAHSCPRPSEVPDLDRIIPVLLEHGLEHLPEHC
RLSPGVPLKPMLAHPTRGVSEILKRFEEAAFTCEYKYDGQRAQVGGWTRSLGRRESAREP
GRAADFHLHVEAFFCVAAVVYARTEVLHYDRERPFVSLRLPFGLAPTSQQPGVSPSTFQI
KLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAADIQVQVCLYAFDLIYLNGE
SLVREPLSRRRQLLRENFVQTEGEFVFATSLDTKDTDQIAEFLEQSVKDSCEGLMVKTLD
IDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDEESE
ELQAICKVPGGWREVDSTQRGGGLNQEALVASLYPRPSLPPTRCCSPQALVLPTPRSYVR
ADGAVAPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFIRVREDKKPE
EATTSAQVASLFKKQSQIQNQQGADLDSDPEDFY
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagtatcatgtcatttttccaccccaagaaggagggcaaagcgaaaaagccg
gagaaagagacctccagcagagagatagagccacctccaaaggtggcgctgaaggaacgg
aacggagaggtgcctgagaacgattctccggtgaagaggccagggcggaaggcggcccgg
gtcctgggcagtgaaggggaggaggaggacgaagccctcacgccctccaaaggccagaag
ccggccccaggctctccacaggtctcccctcccagccctgtcacatttcccgagggcagc
cctcccctctccaacacctctcctgcgggcctctccccaacggggatcccgaagcggcgc
acagctcggaagcagcttcctaaacggccgattcaggatatcctggaagaacagaacgag
gatgaggacagagaggcaaagaggaagaaggaagaagcagagaccccaacagaaagcctc
acagagcctgaattggcccaaaaggaggaagcagaaggggaccggcccacgacgcccgct
gagcacttagagacctccccagccgagcccccgacagacagcacctcagagcctgaggtg
gccggaaagcaggaagcacgggagggggaccaggctaagcctccccccagagctcccaag
acggtcagcagtttcttcgccccccggaagccggcgaccaagaaagaagggaaagaagag
ggacctggcacccctagaaaggaggaggccaaaggacccctggacccccccggctacaat
ccggccaagaacaactaccatcccgttgacgacgcctgctggaagccgggccagaaggtc
ccttacctggctgtggcccggacatttgagaagattgaggaggtttctgctcggctccgg
atggtggagacactgagcaacttgctgcgctccgtggtggccctgtcccccccagacctg
ctccccatcctctacctcagcctcaaccgcctcgggccgccccagcagggcctggagctt
ggcgtcggggacggtgtcctcctcaaggcggtggcccaggccacgggtaagcagggcgtg
tggtggcctttggagcacacccactggcctgcctggcctcagtccacagccaagaagatc
gacgtcatcaaaggcctctttgtcgcctgccgtcactcagaagcccgattcatcgccaga
gccctgagcggacggctacgcctcgggctggcagagcagtcggtgctggccgccctcgcc
caggccgtgagcctcacgcccccccgcccaggtgaggccccgcggctgtctccgcctggc
tgccggagttctggaaggacacctgctcattcttgcccccgccccagcgaggtgcccgac
ctggaccggatcatccctgtgctgctggagcacggcctggagcacctcccggagcactgc
aggctgagcccaggggtccccctgaaaccgatgctggcacaccccacccgcggtgtcagc
gagatcctgaaacgctttgaggaggcggctttcacctgcgagtacaaatacgacgggcag
agggcacaggtaggggggtggacgcgttccctcggcagaagggaaagtgccagagagccg
ggtcgtgccgcagacttccaccttcacgtagaggcctttttctgcgtggcggccgtcgta
tacgcccgcacggaggttcttcactacgacagggaaaggccatttgtgtccctgcgtctg
ccttttggcctcgcccccacctctcagcagcccggggtctccccctccacctttcagatt
aaactgccgtcagtcacatccttcatcctggacacggaagccgtggcttgggaccgggaa
aagaagcagatccagccgttccaagtgctcaccacccgcaaacgcaaggaggtggacgca
gcagacatccaggtccaggtttgtctgtatgccttcgacctcatctacctcaatggagag
tccctggtgcgcgagcccctttcccggcgccgacagctgctccgggagaacttcgtgcag
acggagggcgagttcgtcttcgccacctctctggacaccaaggacacagaccagatcgcc
gagttcttggagcagtccgtgaaagactcctgcgaggggctgatggtaaagaccctggac
atcgatgccacctacgagatcgccaagagatcacacaactggctcaagctgaagaaggac
tacctcgatggcgtgggcgacaccctggacctcgtggtgatcggcgcctacctgggccgt
gggaagcgggccggccgctacgggggtttcctgctggcggcctacgacgaggagagtgag
gagctccaggccatatgcaaggtgccaggaggctggagggaagtcgattcgactcaacgt
ggtgggggcctgaaccaagaggctctcgtggcctctctgtatccaagaccctctcttcct
cccacccgctgctgttccccacaggccctggtgctgcccaccccacgctcctacgtccgg
gccgacggcgccgtggcccctgatcactggctggaccccagcgccgtgtgggaggtgaaa
tgcgccgatctgtccctgtcccccatctaccccgctgcccggggcctggtggatagcgag
aaggggatctccctccgtttcccccggtttattcgcgtccgcgaagacaagaagcccgag
gaggctaccaccagtgcccaggtggcctctctgtttaagaagcagagtcagattcagaac
cagcagggcgcggacttagactccgacccggaagatttctactag

DBGET integrated database retrieval system