KEGG   Panthera tigris altaica (Amur tiger): 102958666
Entry
102958666         CDS       T02988                                 

Gene name
JUN
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04024  cAMP signaling pathway
ptg04137  Mitophagy - animal
ptg04210  Apoptosis
ptg04310  Wnt signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04530  Tight junction
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04668  TNF signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04912  GnRH signaling pathway
ptg04915  Estrogen signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04926  Relaxin signaling pathway
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05030  Cocaine addiction
ptg05031  Amphetamine addiction
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05161  Hepatitis B
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05224  Breast cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05321  Inflammatory bowel disease
ptg05323  Rheumatoid arthritis
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102958666 (JUN)
   04012 ErbB signaling pathway
    102958666 (JUN)
   04310 Wnt signaling pathway
    102958666 (JUN)
   04668 TNF signaling pathway
    102958666 (JUN)
   04024 cAMP signaling pathway
    102958666 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102958666 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    102958666 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102958666 (JUN)
   04530 Tight junction
    102958666 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102958666 (JUN)
   04621 NOD-like receptor signaling pathway
    102958666 (JUN)
   04625 C-type lectin receptor signaling pathway
    102958666 (JUN)
   04660 T cell receptor signaling pathway
    102958666 (JUN)
   04658 Th1 and Th2 cell differentiation
    102958666 (JUN)
   04659 Th17 cell differentiation
    102958666 (JUN)
   04657 IL-17 signaling pathway
    102958666 (JUN)
   04662 B cell receptor signaling pathway
    102958666 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102958666 (JUN)
   04915 Estrogen signaling pathway
    102958666 (JUN)
   04921 Oxytocin signaling pathway
    102958666 (JUN)
   04926 Relaxin signaling pathway
    102958666 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102958666 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102958666 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102958666 (JUN)
   05203 Viral carcinogenesis
    102958666 (JUN)
   05231 Choline metabolism in cancer
    102958666 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102958666 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102958666 (JUN)
   05211 Renal cell carcinoma
    102958666 (JUN)
   05224 Breast cancer
    102958666 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102958666 (JUN)
   05321 Inflammatory bowel disease
    102958666 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    102958666 (JUN)
   05031 Amphetamine addiction
    102958666 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102958666 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102958666 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102958666 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102958666 (JUN)
   05135 Yersinia infection
    102958666 (JUN)
   05133 Pertussis
    102958666 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102958666 (JUN)
   05170 Human immunodeficiency virus 1 infection
    102958666 (JUN)
   05161 Hepatitis B
    102958666 (JUN)
   05171 Coronavirus disease - COVID-19
    102958666 (JUN)
   05162 Measles
    102958666 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102958666 (JUN)
   05169 Epstein-Barr virus infection
    102958666 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102958666 (JUN)
   05142 Chagas disease
    102958666 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102958666 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102958666 (JUN)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    102958666 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 TFIIA Fib_alpha DUF3450 Jnk-SapK_ap_N Paralemmin
Other DBs
NCBI-GeneID: 102958666
NCBI-ProteinID: XP_007089968
LinkDB
Position
Un
AA seq 313 aa
MSPLGAGEGAGEQGAGGRTAGGCARPSRNFPCPGPREGCPPLASALLRPRNFCAQPKLTP
REVTDCSMTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHL
RAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTAGLAFPAQP
QQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERK
RMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNS
GCQLMLTQQLQTF
NT seq 942 nt   +upstreamnt  +downstreamnt
atgtcacccctgggcgcgggggagggagccggtgagcagggcgcaggggggaggacagcc
ggcgggtgcgcgcgcccctcgagaaactttccctgcccagggccccgggaggggtgtcct
ccgctcgccagcgcgctgttgcggccccgaaacttctgcgcgcagcccaaactaacccca
cgtgaagtgacggactgttctatgactgcaaagatggaaacgaccttctacgacgatgcc
ctcaacgcctcgttcctccagtccgagagcggtgcctacggctacagtaaccccaagatc
ctgaagcagagcatgaccctgaacctggccgacccggtgggcagcctgaagccgcacctc
cgggccaagaactcggacctcctcacctcgcccgacgtggggctgctcaagctggcctcg
cccgagctggagcgcctgataatccagtccagcaacgggcacatcaccaccacgccgacc
cccacgcagttcctgtgccccaagaacgtgacagccggcctggcctttcccgcgcagccc
cagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtgcag
cacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggggaa
acgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagaggaag
cgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatcgcc
cggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacggcc
aatatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagt
gggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system