KEGG   Panthera tigris altaica (Amur tiger): 102958863
Entry
102958863         CDS       T02988                                 

Gene name
GGT1
Definition
(RefSeq) gamma-glutamyltransferase 1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00430  Taurine and hypotaurine metabolism
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102958863 (GGT1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102958863 (GGT1)
   00480 Glutathione metabolism
    102958863 (GGT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102958863 (GGT1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102958863 (GGT1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     102958863 (GGT1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     102958863 (GGT1)
    3.4.19.14  leukotriene-C4 hydrolase
     102958863 (GGT1)
Peptidases and inhibitors [BR:ptg01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   102958863 (GGT1)
CD molecules [BR:ptg04090]
 Proteins
  102958863 (GGT1)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 102958863
NCBI-ProteinID: XP_015397616
LinkDB
Position
Un
AA seq 568 aa
MKKRYVVLALLAVVLVIFIIILCLCLLLTSKPQSHVYPRAAVATDAKYCSEIGRDMLRDG
GSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKVEIINAREVAPGLASEGMFNS
PEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWAHLFQPSIQLARQGFPVGKGLAAALEKD
RAVIEEQPALCEVFCRDGKVLREGDRLTMPQLANTYETLALEGAQAFYNGSLTAQIVKDI
QAAGGIMTTEDLNNYRAELIEQPLNISLGDAQLYVPSAPLSGPVLALILNILKGYNFSPA
SVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVNMMEVVRNMSSEFFAAQLRARISDD
TTHPFPYYEPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSRVSGILFNDEM
DDFSSPNITNQFGVPPSPANFIKPGKQPLSSMCPAIIVGRDGQVRMVVGASGGTKITTAT
ALAIIHNLWFGYDVKRAVEEPRLHNQLLPNTTTLEKDTDQAVVAALKTRHHHAEVTSNFI
AVVQAIVHTAGGWAAASDSRKGGEPAGY
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgaagaagcggtatgtggtgctggccctgctggccgtggtcctagtgatcttcatcatc
atcctgtgcctttgcctgctcttgacctccaagccacagagccacgtctaccccagggca
gctgtggccacagatgccaagtattgctcagagatcgggagggacatgctgagggacggt
ggctcggcggtggatgctgccattgcggccctgctgtgtgtggggctcatgaacgcccac
agcatgggcatcgggggcggcctgttcctcaccatctacaacagcaccacgcgaaaagtt
gagatcatcaacgcccgtgaggtggcccctgggctggcctccgaaggcatgtttaacagc
ccggagcagtcacagaaaggggggctgtcggtggcagttcccggtgagatccgaggctat
gagttggcccaccagcggcatgggcggctgccctgggctcacctctttcagcccagcatc
cagctggcccgccagggcttccctgtggggaagggcttggcggcagccctggagaaagac
agggctgtcatcgaggaacagcctgcactgtgtgaggtgttctgccgggatgggaaggtg
ctgcgggagggggacagactgaccatgccgcagctggccaacacatacgagacgctggcc
ttggagggagcccaggccttctacaacgggagcctcacagcccagattgtcaaggacatc
caggcggccgggggcattatgaccaccgaggacctgaacaactaccgtgccgagctgata
gagcagccactgaacatcagcctcggggacgcccagctctacgtgcccagtgccccactc
agtgggcccgtgctggctctcatcctcaacatcctcaaggggtacaacttctccccagcg
agtgtggagacacccgaacagaagggtctgacctaccaccgcattgtggaggccttccgg
tttgcctatgccaagaggaccctgcttggggaccccaagtttgtcaatatgatggaggtg
gtccgcaacatgagctccgagttctttgccgcccagctccgggcccggatctctgatgat
accactcacccgttcccctactatgagcctgagttctacacgcctgatgatggtggcact
gcccacctgtccgtggttgcagaggacggcagcgctgtgtcggccaccagcaccatcaac
ctctactttggttctaaggtacgatcacgggtcagtgggatcctcttcaatgatgaaatg
gatgacttcagctcccccaacatcaccaaccagttcggggtgcccccctcaccagccaac
ttcatcaaaccagggaagcagccactctcatccatgtgtccagcgatcatcgtgggccgg
gatggccaggtccgcatggtggtgggtgcctctgggggcacgaaaatcaccacagccact
gcgctggccatcatccataacctgtggtttggctacgatgtgaagcgggcagtagaggag
ccccgactgcacaaccagcttctgcctaacaccacgaccctggagaaagacactgaccag
gcagtggttgcagccctgaagacccggcaccaccacgctgaggtcacttccaacttcatc
gctgtggtacaggccattgtccacacggctggtggctgggcagctgcctcagattccagg
aaaggcggggagcctgctggctactga

KEGG   Panthera tigris altaica (Amur tiger): 102959431
Entry
102959431         CDS       T02988                                 

Gene name
GGT5
Definition
(RefSeq) gamma-glutamyltransferase 5
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00430  Taurine and hypotaurine metabolism
ptg00480  Glutathione metabolism
ptg00590  Arachidonic acid metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102959431 (GGT5)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102959431 (GGT5)
   00480 Glutathione metabolism
    102959431 (GGT5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102959431 (GGT5)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102959431 (GGT5)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     102959431 (GGT5)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     102959431 (GGT5)
    3.4.19.14  leukotriene-C4 hydrolase
     102959431 (GGT5)
Peptidases and inhibitors [BR:ptg01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   102959431 (GGT5)
CD molecules [BR:ptg04090]
 Proteins
  102959431 (GGT5)
SSDB
Motif
Pfam: G_glu_transpept RecO_C
Other DBs
NCBI-GeneID: 102959431
NCBI-ProteinID: XP_007092372
LinkDB
Position
Un
AA seq 570 aa
MAQGRRATVSMVLLGLGLALAIIVPAVVLSRHHAHCGSQAFAHAAVAADSKVCSEIGRAI
LQQHGSPVDAAIAALVCTGAVNPQSMGLGGGVIFTIYNATTGKVEVINARETVPASYVPR
LLDQCEQAQPLGTGAQWIGVPGELRGYAEAHRRHGHLPWAQLFWPTISLLRGDYRMPFTL
SQFLQSDFLRPSLYMTSLRQLFFNGTEPLKAQDPFPWPALAATLETVATEGAEVFYTGTL
GRTLLEDIANQGSQLTLQDLAEFQPEVVDALAVPLEDYTLYSPPPPAGGAILSFILNVLK
GFNFSSESVARPEGRVNLYHHLVETLKFAGGQRWRLWDPRSHPDIQNASQDLLGEALAQH
IQQQIDARGDHHLSHYSLAGAWGHGMGTAHVSVLGEDGSAVAATSTINTPFGAMLYSPRT
GILLNNELLDLCWRRSPDSRVTPLPVPGERPPSSMVPSILISAAQGSKLVIGGAGGELII
PAVAQAIINKLWLGFDLRTAIEAPILHVNSEGHVEYEPNFSREVQKGLQDRGHNQTMRPF
FLNVVQAVSQDGACVYAAADPRKGGEASGY
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggcccagggacgcagggccacggtcagcatggtccttctgggattggggctggcccta
gccatcatcgtgcccgccgtggtcctctctcgccaccatgcccactgcggctcccaggcc
tttgcccacgctgcggtcgccgctgactccaaggtctgctcggagattggacgagccatc
ctccagcaacatggctcacctgtggatgccgccattgcggctctggtctgcaccggagcc
gtcaaccctcagagcatggggttgggcggaggggtcatcttcaccatctataacgccacc
acagggaaggtggaagtcatcaatgccagggagacggtgcctgccagctatgtcccccgt
ctgctggaccagtgtgagcaggcccagccactgggcacaggggcccagtggattggagtg
cccggggaactccgtggctatgctgaggcccaccgtcgccacggccacctgccgtgggca
cagctgttctggcccaccatctccctgctccgaggggactaccgcatgccctttaccctc
agtcagttcctgcagagtgacttcctacggccttccctgtacatgacttctctgaggcag
ctctttttcaatgggacagaacctctgaaggctcaggacccattcccatggcccgcgttg
gctgccaccctggaaaccgtggccacagaaggtgcagaggtcttctacacagggacgctg
ggccggacactgctggaggacattgccaatcaaggtagccagctgaccctgcaggacctg
gcagagttccagccggaggtagtggatgccctggcagtgcccctggaggactacacccta
tactcaccgccaccacccgcagggggtgccattctcagcttcatcctcaacgtgctcaaa
gggttcaacttctcctctgagtcggtggccaggcccgaggggagagtgaacttgtaccat
caccttgtggagacgctcaagtttgccggcggacagaggtggcgactgtgggaccctcgt
agccacccggatatccagaacgcctcccaggacctgctgggagaggctttggcccagcac
atccagcagcagatcgacgctcggggtgaccatcatctcagccactacagcctggccggg
gcctggggccacgggatgggcacagcgcacgtttctgtgctgggggaggatggcagtgct
gtggcagccacgagcaccatcaacacgccctttggagcaatgctgtactcgccacgcacg
ggcatcctcctcaacaatgagcttctggacctatgctggaggcgctcaccggactccaga
gtcaccccactacctgttccaggcgagcgacctccatcatccatggtgccctccatcttg
atcagtgcagctcaggggtcaaagctggtgatcggtggggctggtggggagctcatcatc
cctgctgtggctcaggccatcataaacaagctatggcttggctttgacctgaggactgcc
attgaagcccctatcctgcatgtcaacagcgagggccatgtggaatatgagcccaacttc
agccgggaggtgcagaaggggctccaggacaggggccacaaccagaccatgaggcccttt
ttcctgaacgtggtccaggccgtgtcccaggacggggcctgtgtgtatgcagcagcggac
ccaaggaaaggtggggaggcgtcgggctactga

KEGG   Panthera tigris altaica (Amur tiger): 102964946
Entry
102964946         CDS       T02988                                 

Gene name
GGT7
Definition
(RefSeq) gamma-glutamyltransferase 7
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00430  Taurine and hypotaurine metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102964946 (GGT7)
   00480 Glutathione metabolism
    102964946 (GGT7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102964946 (GGT7)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     102964946 (GGT7)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     102964946 (GGT7)
Peptidases and inhibitors [BR:ptg01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   102964946 (GGT7)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 102964946
NCBI-ProteinID: XP_007073744
LinkDB
Position
Un
AA seq 586 aa
MGSQDGSPLRETRKDPFSAAAAECSCRQDGLTVIVTACLTFATGVTVALVMQIYFGDPQI
FHQGAVVTDAAHCTSLGIEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIR
RNESHLIDFRESAPGALREEALQRSWETKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLA
FAAAVAQDGFNVTHDLARALAEQPPPNASERFRETFLPLGHPPLPGSLLRRPDLAAVLDV
LGTSGPTAFYAGGNLTLEMVAEAQHAGGVITEEDFSNYSALVENPVCGVYRGHLVLSPPP
PHTGPALISALNILEGFNLTTLVSREQALHWVAETLKIALALASRLGDPVYDSTITESMD
DMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMGPDDFIVAMVSSLNRPF
GSGLITPSGILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLCG
TYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLAHGRLHPDLQSNLLQVDSEFTEEEI
EFLEARGHHVEKVDVLSWVHGSRRTNNFIIGVKDPRSPDAAGATIL
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgggcagccaggacgggtcgccgctgcgggagacacgcaaggacccgttctctgcggca
gcggccgagtgctcctgccgccaggacgggctcacagtcatcgtcacggcctgcctcact
tttgccacgggtgtcactgtggcgcttgtcatgcagatttacttcggggaccctcagatc
tttcaccagggtgcggtggtgactgatgctgcccattgcacatcgctgggcatcgaggtg
ctcagtaaacagggatcttccgtggatgccgctgtggcagcagccctgtgcttggggatc
gtggctccacacagttctggcctgggcggtggcggcgtgatgctggtacatgacatccga
agaaatgagagccacctaattgacttccgggagtctgcaccaggggccctcagggaagag
gccctgcagagatcctgggaaaccaagcctgggctcttggtgggggtccccggaatggtg
aaggggctacatgaagctcaccagctctatggcaggctgccatggtcccaagtcctggcc
ttcgcagcagctgtggcccaagatggcttcaacgtgacccatgatctagcccgagccctg
gccgaacagcctccgcccaatgcatctgagcgtttccgtgagacattcctgccattgggc
cacccgccactacctggctcactgctgcgtcggcctgacctggctgcagtgctggatgtg
ctgggcacctctggccccaccgccttctacgcaggaggcaatcttacactggagatggtg
gctgaggctcaacatgcagggggtgtcataactgaggaggatttcagcaactacagtgcc
ctcgtggagaatcctgtgtgtggcgtctacagaggccacctggttctcagtcccccaccc
ccgcatacagggcctgccctcatcagtgctctcaacatccttgaaggcttcaatcttacc
accctggtgtcccgggaacaggctcttcactgggtggcagagaccctgaagattgcatta
gccctggccagcagactgggagatcctgtctacgattctaccatcactgagagcatggat
gacatgctcagcaaggtggaagctgcgtacctccggggccacatcaatgactcccaggcg
gctcctgctccactcctgcctgtctacgagctggatggggctcccacggctgcccaggtg
ctgatcatgggccctgatgactttatcgtggccatggtcagctccctgaaccgacccttt
ggcagtggcctcatcactccctcggggatcctgctcaacagccagatgctagacttctcc
tggcccaacaggactgctaaccactctgctcccagcctggagaattcggtgcagccaggg
aagcgaccactgtctttcctgctgcccactgtggtccggccggcagaggggctctgtggg
acctacctcgcactgggggccaatggagctgcccggggcctcagcggcctgacccaggtt
ttgctgaatgtcctgaccttgaaccggaacctgagtgacagcctggctcatggccgtctg
catccagacctgcagtctaaccttctgcaggtggacagtgagttcacagaggaagagatt
gagttcctggaagccaggggtcaccatgtggagaaggtagatgtcttatcctgggtccat
ggcagccggagaaccaacaacttcatcattggtgtgaaagaccctcggagcccagacgca
gctggagccaccatcctgtag

KEGG   Panthera tigris altaica (Amur tiger): 102970266
Entry
102970266         CDS       T02988                                 

Gene name
GGT6
Definition
(RefSeq) gamma-glutamyltransferase 6
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00430  Taurine and hypotaurine metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102970266 (GGT6)
   00480 Glutathione metabolism
    102970266 (GGT6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102970266 (GGT6)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     102970266 (GGT6)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     102970266 (GGT6)
Peptidases and inhibitors [BR:ptg01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   102970266 (GGT6)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 102970266
NCBI-ProteinID: XP_015397028
LinkDB
Position
Un
AA seq 338 aa
MEPTAGPVLYRQLQLWDPSLESGQEEEEEEEETSELVVPDPRRPQDSSRDEAGGLPGAWP
PCPDSRVTPSSPPGATFWGLFHNSTSGSSTALTPGPARTLPKLAAVLRGAALAPTPDLAG
DALLSLLARDLGLRGPSPGPGPTLEPALQLPMPQGILSTTPSPSAGPELLARVEAALRSG
GPSPDPCLLVPRAPVTPGSGVLATIDSSGSVLLLTSSLNSSFGSGHLSPSTGVLLSDLVA
ESASGGWACPLVLHGGSDDTEADVLGLVASGNPVVARVTTRALLSRLAGPQAQAQQQQQG
PTQSPSICGQGTLLQVAAHAEHAHVSSVPSGCCPFQGF
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggaacccacagcagggcccgtgctgtaccgacagctgcagctctgggatccaagcttg
gagtccgggcaggaggaggaggaggaagaggaggagacctcggagctggtcgttcctgac
ccccggaggccccaggactcctctagggacgaggccggtgggctgcccggggcctggccc
ccgtgccctgactcccgtgtgaccccttcatctcctccaggtgccacgttctggggcctc
ttccacaatagcacctcgggcagttccactgccctgacgccaggtccggcccggacgctg
cccaaactggccgccgtgctacgcggggcggcactggcccccaccccagaccttgccggg
gacgccctgctgagtctgctggccagagacctggggctgcggggaccctcccctgggccc
gggcccaccctggagccagccctgcagctacctatgccccagggcatcctgtccaccacc
cccagcccctcagctggcccagaactgctggcgagggtggaggcggccttgcgctctgga
gggcccagccctgacccctgcctgttagtcccacgagctcccgtgacccccgggagcggc
gtcctggccaccatagacagcagcggctctgtgctcctcctcacctcctcactcaacagc
tcctttggctctggacatctgtccccaagcaccggggttctgctgagcgacctggtggcc
gagtctgcaagtgggggctgggcttgccccctcgtcctccatggtggctctgatgacaca
gaggctgatgtgttggggctggtggcttcaggaaaccccgtagtggccagagtcacgact
cgtgccctgctcagtcgcctggcggggccccaagcccaggcccagcagcagcagcaggga
ccaacacagagccctagcatttgtggtcaagggaccctgctccaggtagctgctcacgca
gagcatgctcacgtctccagtgtccccagtggctgctgccccttccagggcttctaa

DBGET integrated database retrieval system