KEGG   Panthera tigris altaica (Amur tiger): 102958898
Entry
102958898         CDS       T02988                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg03440  Homologous recombination
ptg04064  NF-kappa B signaling pathway
ptg04068  FoxO signaling pathway
ptg04110  Cell cycle
ptg04115  p53 signaling pathway
ptg04210  Apoptosis
ptg04218  Cellular senescence
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05202  Transcriptional misregulation in cancer
ptg05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102958898 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102958898 (ATM)
   04068 FoxO signaling pathway
    102958898 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102958898 (ATM)
   04210 Apoptosis
    102958898 (ATM)
   04115 p53 signaling pathway
    102958898 (ATM)
   04218 Cellular senescence
    102958898 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102958898 (ATM)
   05206 MicroRNAs in cancer
    102958898 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102958898 (ATM)
   05170 Human immunodeficiency virus 1 infection
    102958898 (ATM)
   05165 Human papillomavirus infection
    102958898 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102958898 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102958898 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ptg03032]
    102958898 (ATM)
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102958898 (ATM)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102958898 (ATM)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102958898 (ATM)
DNA replication proteins [BR:ptg03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102958898 (ATM)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102958898 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC Uso1_p115_head
Other DBs
NCBI-GeneID: 102958898
NCBI-ProteinID: XP_007077731
LinkDB
Position
Un
AA seq 3057 aa
MSLALNDLLICCRQLEHDRATERRKEVEKFKRLIRDPETVQHLDRHSDSKQGKYLNWDAV
FRFLQKYVQKETECLRTAKAGVSASTQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYVMDTVKDSFNGTVYGADCSNILLKDILSVRKYWCEITQQQWLELFSVYFNLYLKPAQ
DINRVLVARIIHAVARGCCSQTDGLNSKLLDFFSKAIHHARQEKSSAGLNHILAAFVIFL
KTLAVNFRICVCQLGDEVLPTLLYIWTQHRLNDCLKEVIIELFQLQIYIRHPKGAKTQEK
GAYESHKWKSILYNLYDLLINEISHIGSRGKYSSGSRNVAVKENLINLMADICHQVFNED
TRSLEISQSYAITQRELNDYGATCKKRKIELGWDVIKDHLQKSQNDFDLVPWLQIATQLI
SKYPSSLPNYELSPLLMILYQLLPQQRHGERTPYVLRCLVELASCQGKKSDLESSQKSDL
LKLWTKIWSITFRGISSERIQAENFGLLGAIIQGGLIEVDREFWKLFTGSACRPSCSAVC
CLTLALTICVVPETVKTGVEQNTCEVNRSFSLKELIMKWLLFYQLEDDFEDSTEPPPVLH
SNFPHLALEKILVSLTMKNSKAAMNFFQRVPECEQHHKDAEESSFSEIEELFLQTTFDKM
DFLTIVKECPVEKLQSSGGISVHQNLKESLDRCLLGLSEQLLNNYSFESTDAEMLIRCSS
LVVGVLGCYCYMGVIAEEEAYKSELFQKAKSLMQCAGESITVFKNKPHEESRIVSLRNLM
HLCTRCLSNCTGPSPSKIASGFFLRLLTSKLMNDIADICRSLASFSRKPFDYGEVESVED
DPDESLMEAEDQSSMSLFSDYPAGSVSDANVSGEGQNTIGAMNPLAEEHLSKQDLLFLDM
LKFLCMCVTTAQTSTVSFRAADIRRRLLMLIDSSMLDPAKSLHLHMYLVLLKELPGEEHP
LPMEEVVELLKPLSNVCSLYRRDQDVCKTVLNHVVHIVMNLCQGSMDAENTRDAQGQFLT
VIGAFWHLAKEGKCTFSVRMALVKCLKTLLEADPYSKWAILNVMGKEFPVNEVFPHFLAD
NHHQVSMLAAESINRLFQDMKHGGSSTLLKALPLKLQQTAFENAYSKAQEGMREVAHRAE
NAELVDEVYNRKSVLLMTMAVILCCSPVCEKQALFALCKAVKESGLEPHLIKKVLEKVSE
TFGYRHLEDFMASHLDYLVLEWLNLQDTEHSLCSFPFILLNYTNVEDFYRSCYKVLIPHL
VIRSRFDEVKSIANQIQEDWKTLLTHCFPKILVNILPYFAYEGTGESETAQQRETATKVY
DTLKDENFLGKQIDHLFLSNLPEIVVELLMTLHEPATSGGSQSTDLGDFSGDLDPAPNPP
HFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQATETNNVYKKHRIL
KIYHLFVSLLLKDIKSTLGGAWAFVLRDVIYTLIHYINKRPSRFMDVSLRSFSLCCDLLS
RVCHTAVTYCKDALENHLHVIVGTLIPLVDDQMEVQEQVLDLLKYLVIDNKDNENLYMTI
KLLDPFPDHDVFKDLRLTQQKIKYSKGPFSLLEEINHFLSVSVYDALPLTRLEGLKDLRR
QLAQHKDQMMDLMRASQENPQDGIMVKLIVSLLQLCKMAVSHTGEREVLEAVGSCLGEVG
PIDFSTIAIQHSRDTSSTKALEFFEDKELQWTFLTLTYLNNTLVEDCVKVRSAAVTCLKS
ILATKTGHTFWEIYKTTTDPMLIYLQPFRTSRKKFLEVPRLDKESPLEGLDDTSLWTPQS
GNHDSWIKRLTCAFLDSGGTKSEILQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWR
TLLSTHIQGFFTNCFRHSSQTSRSTTPANLDSDSEHFFRCCVDKKSQRTMLAVVDYMRRQ
RRPSLGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKSTDDQEKRSLMFEE
ASQNTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRTYEHE
AMWGKALVTYDLESAISSSTRQAGIIQALQNLGLCHILSVYLKGLDLENKEWSAELQELC
YQAAWRNMQWDHCVSANKGMEGTSYHESVYNALQSLRDREFSTFYESLKYARLREVEELC
RGSLESVYSLYPTLGRLQAIGELENIGELFSRSVPGRQPSEVYAKWRKHSQLLKDSDFSF
QEPIMALRTVILEILMEKEMENSQRECFKDILTTHLVELSILARTFKNTQLPERAIFHIK
QYNPPGRGVSEWQLEEAQVFWARNEQSLALSVLKQMIKKLDSSGAENDPSLRLLYTECLR
VCGTWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQ
RIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTTRYTIKVQRELELDECALRALKEDR
KRFLCKAVENYISCLLSGEAHDMWIFRLCSLWLENSGVSEVNGMMKSKGMNIPSYKFLPL
MYQLAARMGTKMMGGLGFHEVLNNLISTIAMDHPHHTLFIILALANANKDEFLTKPEAAR
RSRISKNAPKQSSQLDEDRTEAANRIICTIRSRRPHMVRSVEALCDAYIILANLDATQWR
TQRKGINIPADQPITKLKNLEDVVVPTMEIKVDPTGEYGNLVTIQSFKAEFHLAGGLNLP
KIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVP
LSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSALQCQKKMMDVQKKSFEEKYKT
FTDICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILIN
EQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMR
SSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDDAELQSTPSADDQECRRGLGDLD
QSLNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9174 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaacgatctgcttatttgctgtcgtcaattggaacacgatagagct
acagaacgaaggaaagaagttgagaaatttaagcgccttatccgggatcctgaaactgtt
caacacttagatcggcattcagattccaaacaagggaaatacttgaattgggatgctgtt
tttagatttttacagaaatatgttcaaaaagaaacagaatgtctgagaacagcaaaagca
ggtgtatcagcctcaacacaagccaccaggcagaaaaagatgcaagaaattagtagtctg
gtcaaatacttcatcaaatgtgcaaataaaagagcacccagactaaaatgtcaagaactc
ttgaattatgtcatggatacggtgaaagattcgtttaatggtactgtttatggagccgac
tgcagcaacatactgctcaaggatattctttcagtgagaaaatactggtgtgaaataact
cagcaacagtggctagagttgttctctgtgtacttcaatctgtaccttaaacctgcacaa
gacattaatagagttttagtggctagaataattcatgctgtggccagagggtgctgttcc
caaactgatggattgaattccaaattgttggatttcttttccaaagcgattcatcatgca
agacaagagaagagctctgcaggtctaaaccacatcttagcagcatttgttatcttcctc
aagacgttggctgttaactttcgaatttgcgtgtgtcagttaggagatgaagttcttcct
accttgctttatatttggactcaacacagacttaatgattgtttaaaagaagtgattatt
gaattatttcagctgcaaatttatatccgtcatccaaagggagctaaaacccaagagaaa
ggtgcttatgaatcacataaatggaaaagtatcttatacaacttatatgatctgctgatt
aatgagataagtcatataggaagcagagggaaatactcttcaggatcccgtaatgttgct
gtcaaggaaaatttgattaacctgatggcagatatttgtcaccaggtttttaatgaagat
accagatctttggagatttctcaatcttacgctatcacacaaagagaacttaatgattac
ggtgcaacttgcaaaaagaggaaaatagaattaggctgggacgtaataaaagatcatctt
cagaagtcacagaatgattttgatcttgtgccttggttacagattgcaacccaattaata
tcaaaatatccttccagtttacctaactatgagttgtcaccattactgatgatactgtac
cagcttctgcctcagcagcgacatggggagcgcacgccatacgtgttacggtgccttgtg
gagcttgcatcgtgtcaaggcaagaaatcagacctggaaagctcacagaaatcagattta
ttgaaactctggactaaaatttggtctattacttttcgcggtataagttctgaacgaata
caagctgaaaactttggcttacttggagctataattcaaggtggtttaattgaggttgat
agagaattctggaagttatttactgggtcagcctgcagaccttcatgttctgcagtgtgc
tgcttgactttggccctgaccatctgcgttgttccagaaacagtaaagacaggagtggag
cagaatacatgtgaagtaaatagaagtttttcgttaaaggaattgataatgaaatggctc
ttattctatcagttagaggatgactttgaagacagtaccgagccgcccccagttcttcac
agtaattttcctcatcttgcgctggagaaaattcttgtgagtctcactatgaaaaactct
aaagctgcaatgaattttttccaaagagtgccagaatgtgaacaacaccacaaagatgca
gaggagtcttcgttctcagaaattgaagaactgtttcttcagacaactttcgacaagatg
gatttcttaaccattgtgaaggaatgtcccgtagaaaagctccagtccagtggaggcatt
tctgtccaccagaacctcaaggaatcactggatcgctgtcttctggggttatcagaacag
cttctaaataactactcctttgagtctacagatgcagaaatgcttatccgatgttcaagt
cttgtggtgggtgttcttggctgctattgttacatgggtgtaatagctgaagaggaagca
tataaatcagagttgttccagaaagccaagtctctcatgcagtgtgccggagaaagtatc
actgtgtttaaaaataagccccatgaagaatctaggattgtctcgctgagaaatttgatg
catctctgtacacgttgcttgtctaactgtaccgggcccagtccaagtaagattgcatct
ggatttttcctgagattgttgacatcaaagctaatgaatgatattgcagatatttgtaga
agtttagcatccttcagcagaaagccatttgactatggagaagtggaatcagtggaagat
gatcctgacgaaagtctgatggaggcggaggatcagtcatccatgagtctattcagtgat
taccctgccggcagtgttagtgatgctaacgtatctggagagggtcaaaatactattggt
gccatgaatcctttagctgaagaacatctttcaaagcaagatctacttttcctcgacatg
ctcaagttcttgtgtatgtgtgtaactaccgctcagactagtaccgtgtcgttcagagca
gctgacattcggaggagactgttaatgttaattgattccagcatgctggaccctgctaaa
tccctccacctgcacatgtatctagtgcttttaaaggagcttcctggagaagaacatcct
ttgccgatggaagaggttgttgaactcctaaagccactatccaacgtgtgttctttgtat
cgccgtgaccaggatgtttgcaagacagttttaaaccacgtcgttcatatagtgatgaac
ctgtgtcaaggcagtatggatgctgaaaacacaagggatgcccaagggcagtttctaaca
gtgattggagcgttctggcacttagcaaaggaggggaaatgcacattctctgtaagaatg
gcactagtaaaatgccttaaaactttgctcgaggctgatccttattcaaaatgggctatt
cttaatgtgatgggcaaagagtttcctgtgaacgaagtctttccacattttcttgctgat
aatcatcatcaagttagcatgttggccgcagagtccatcaatagattattccaggatatg
aagcacggaggttcttccacattattgaaagcacttcctttgaagcttcagcaaacagcc
tttgaaaatgcatactcgaaagctcaggaaggaatgagagaagtagcccacagagctgag
aacgctgaactcgtagatgaggtttataacagaaaatctgtcctgctgatgacgatggct
gtgattttatgctgcagccccgtctgtgagaaacaggctttgtttgccctgtgcaaggct
gtgaaagagagtggattagaacctcacctcattaaaaaggttttagagaaagtttctgaa
acctttgggtacagacatttagaagacttcatggcttctcatttggattatctggttttg
gaatggctgaatcttcaagatactgaacacagcttatgttcttttccttttattttatta
aactacacaaatgttgaggatttctatagatcttgttacaaggttttgatcccacatctg
gtgattagaagtcgttttgatgaggtgaagtccattgctaatcagattcaagaggattgg
aaaactcttctaacacactgttttccaaagattcttgtaaatattcttccttactttgcc
tatgagggtacaggagaaagtgagacagcacagcagagagagactgctaccaaagtctac
gacacactcaaagatgaaaactttctaggaaaacagattgatcacttattcctcagtaat
ttaccagagattgttgtggagttactgatgacgttacacgaaccagcaacttctggtggc
agccaaagcactgacctcggtgacttttcaggggatttggaccctgctcctaacccacct
catttcccatcacacgtgatcaaagcaacgtttgcctatatcagtaattgccataaaacc
aagcttaaaagcatcttagaaattctttccaaaagccctgattcctatcagaaaattctt
ctagccatatgtgaacaagccactgagacaaataatgtttataaaaagcacagaattctg
aaaatatatcacctatttgttagtttattactgaaagacataaaaagtaccttaggagga
gcatgggcctttgttcttcgagacgttatttacactttgattcattatatcaacaaaagg
ccttctcgtttcatggacgtgtcgttacgaagcttctccctgtgttgtgacctgttaagc
cgggtttgccacacagcagtcacttactgcaaggatgctttagaaaatcaccttcacgtc
attgtcggtacactcataccccttgtggatgatcagatggaggttcaggaacaggtattg
gacttgttgaaatacttagtgatagataacaaggataatgaaaacctctatatgacaatt
aaacttttagatccttttcctgaccatgatgtctttaaggatttgcgtcttactcagcag
aaaattaaatacagtaaaggacccttttcacttttggaggaaataaatcattttctctcc
gtgagtgtttatgatgcacttcctttgacaaggctcgaagggttgaaggatcttcgcaga
cagctggcacaacataaagatcagatgatggatctcatgagagcatctcaggaaaaccca
caagatggcataatggtgaaactaatcgtcagcttgttgcagttatgcaagatggcagtg
agccacactggtgaaagagaagttttagaggctgttggaagctgcctgggagaagtgggt
cctatagacttctcgacgatagctatccagcatagcagagatacatcttctaccaaggcc
ctggagttctttgaagataaagaacttcagtggaccttcctaacgctgacctacctgaat
aatacgctagtagaagattgtgtcaaagtgcgatcagctgctgttacctgtttgaaaagc
atcttagccacaaagactggacatactttctgggagatttataagacgacaactgatccc
atgctgatctatctacagccttttagaacatcgagaaaaaagtttttagaagtacccaga
ctggacaaagaaagtcctttagaaggcctggatgatacgagcctgtggactcctcaaagt
ggaaatcatgacagttggataaagaggctgacttgtgcatttttggatagtggaggcaca
aagagtgaaattcttcaattattaaagccgatgtgtgaagtgaaaactgacttttgtcag
actgtgcttccatacttgattcatgatattttactccaagatacaaatgaatcatggaga
actctgctgtctacacacattcagggatttttcactaactgtttcagacactcctcacaa
acgagccgatccacaacccctgcaaatttggattcagactcagagcactttttccgatgc
tgtgtggataaaaagtcgcagaggaccatgcttgctgttgtggactacatgaggagacaa
aggagaccttccttaggaaccgtttttgatgatgctttctggctggagttgaattacctg
gaggttgctaaggtggctcagtcttgtgctgctcactttacagcattgctctacgcagaa
atttatgcagataagaaaagcacagatgaccaggagaaaagaagccttatgtttgaagaa
gcaagccaaaatacaacgatttctagtttgagtgaaaaaagtaaagaagaaactggaata
agtttacaggatctgctcttagaaatctatagaagtatcggagagccagatagcctgtac
ggctgtggtggggggaagatgctccagccccttaccaggctgcgaacgtacgagcatgaa
gccatgtgggggaaagccctggtgacatatgaccttgagtcggcaatctcctcatccacc
cgccaggcaggaatcatccaggccctgcagaatttgggactctgccatatcctttccgtc
tatttaaaaggattagaccttgaaaataaagagtggagtgcagagctgcaggagctctgt
taccaagcagcgtggaggaatatgcagtgggaccactgtgtttctgccaataaaggaatg
gagggaaccagttaccatgaatccgtgtacaatgctctacagtctctgagagatagagaa
ttctccacattttatgaaagtctcaaatatgccaggctgagagaagtggaggagctgtgt
aggggcagcctcgagtccgtgtactcgctctaccccaccctcggcaggctgcaggccatt
ggagagctcgaaaacatcggggagcttttctccagatcggtccccggtaggcagccctcc
gaagtctacgctaagtggcggaaacactcccagcttctcaaagacagtgactttagtttt
caggagcccatcatggctctccgcacagtcattttggagatcttgatggaaaaggaaatg
gaaaactcccagagagaatgttttaaggatattctcaccacgcaccttgtagaactctcc
atactggcccgaacttttaagaacactcagctccccgaacgggcaatatttcacattaaa
cagtacaacccacctggtcgtggagtctccgagtggcagctggaggaggcccaagtattt
tgggcaagaaacgagcagagtctcgccctgagtgtcctcaagcagatgatcaagaagctg
gactccagtggtgcagagaatgatcccagcctaagacttctgtacacagaatgtctgagg
gtttgcggcacctggttggcggaaacttgcttagaaaaccctgcggtcatcatgcagacc
tacctggaaaaggcagtggaagttgctggaaattatgacggagaaagcagtgatgagctt
agaaatggaaaaatgaaggcatttctctcattagcacggttctcggatacgcagtaccag
agaattgaaaactacatgaaatcatcagaatttgaaaacaagcaggctctcctgaaaagg
gccaaagaggaagtgggccttcttagggagcataaaattcagaccaccagatacacgata
aaggtgcagcgagagctggagctggatgagtgtgcgctccgtgccctgaaagaggatcgt
aagcggttcttatgtaaagcagttgaaaattacatcagttgcttattgagtggagaagcg
catgatatgtggatattccgtctttgttctctctggcttgaaaattctggagtttctgaa
gtcaatggcatgatgaagagcaaaggaatgaacattccgtcatacaaattcctgcctctt
atgtaccagctggctgctagaatggggaccaaaatgatggggggcctaggattccacgaa
gtcctcaataaccttatctctacaattgctatggatcacccccatcataccttgtttatt
atattggctttagcaaatgcaaacaaagatgaatttttgaccaaaccagaggcggcaaga
aggagtagaataagtaaaaatgcacctaaacaaagctctcagcttgatgaggatcgaacc
gaggctgcaaacagaataatatgtactatcagaagtaggagacctcatatggtcagaagt
gtagaggcactttgtgatgcttacatcatattagcaaacttagatgccactcagtggagg
acgcagagaaaaggcataaatatcccagcagaccagccaattactaaactgaagaattta
gaagatgttgttgtcccaactatggaaattaaggtggatcctactggagaatatggaaat
ctggtgactatacagtcatttaaagcagaatttcatttagcaggaggtttaaatttacct
aaaataatcgattgtttgggctctgatggaaaggaaaggagacagcttgtcaagggccgt
gatgacctgagacaagacgccgtcatgcagcaggtgttccagatgtgtaacacgttgctg
cagagaaacaccgagaccaggaagaggaaattgactatctgtacatacaaggtggttccg
ctttctcagcgaagtggagttctcgaatggtgcacgggaaccgtccctatcggtgaattt
cttgttaacaacgagaatggcgctcataagcgatacaggccgaaggatttcagcgccctt
cagtgccaaaagaaaatgatggatgtacaaaagaagtctttcgaagagaaatataaaacc
ttcacggatatctgccaaaattttcaaccagttttccgttacttctgcatggaaaaattc
ttggacccggctgtttggttcgagaagcgactggcttacacgcgcagcgtggctacttct
tctatcgtcggttacatacttggacttggtgatagacacgtacagaacatcttgataaat
gagcagtccgcagagctcgtacacatagatttaggagtcgcttttgaacagggtaaaatc
ctgcctactcctgagacggttcctttcagactcaccagagatattgtggatgggatgggc
attactggtgttgaaggggtcttcagaagatgctgtgagaaaaccatggaggttatgaga
agctctcaggaaaccctgttgaccatcgtggaggtcctcctgtacgatcccctctttgac
tggaccatgaatcctttgaaagctctgtatttacagcagaggccggaggacgacgcggag
ctccagtccactcccagtgcggacgaccaggagtgcagacgcggtctcggtgacctcgac
cagagtttgaacaaagtggccgaacgcgtcctgatgcggctccaagagaaactgaaaggg
gtggaggagggaaccgtgctcagcgtcggggggcaggtgaatctgctcatacagcaggcc
atggaccccaagaacctcagccggctcttcccgggatggaaagcgtgggtgtga

DBGET integrated database retrieval system