KEGG   Panthera tigris altaica (Amur tiger): 102958919
Entry
102958919         CDS       T02988                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01523  Antifolate resistance
ptg04010  MAPK signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04061  Viral protein interaction with cytokine and cytokine receptor
ptg04064  NF-kappa B signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04150  mTOR signaling pathway
ptg04210  Apoptosis
ptg04217  Necroptosis
ptg04350  TGF-beta signaling pathway
ptg04380  Osteoclast differentiation
ptg04612  Antigen processing and presentation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04640  Hematopoietic cell lineage
ptg04650  Natural killer cell mediated cytotoxicity
ptg04657  IL-17 signaling pathway
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04668  TNF signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04940  Type I diabetes mellitus
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05205  Proteoglycans in cancer
ptg05310  Asthma
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05410  Hypertrophic cardiomyopathy
ptg05414  Dilated cardiomyopathy
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102958919 (TNF)
   04350 TGF-beta signaling pathway
    102958919 (TNF)
   04064 NF-kappa B signaling pathway
    102958919 (TNF)
   04668 TNF signaling pathway
    102958919 (TNF)
   04071 Sphingolipid signaling pathway
    102958919 (TNF)
   04150 mTOR signaling pathway
    102958919 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102958919 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102958919 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102958919 (TNF)
   04217 Necroptosis
    102958919 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102958919 (TNF)
   04620 Toll-like receptor signaling pathway
    102958919 (TNF)
   04621 NOD-like receptor signaling pathway
    102958919 (TNF)
   04622 RIG-I-like receptor signaling pathway
    102958919 (TNF)
   04625 C-type lectin receptor signaling pathway
    102958919 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    102958919 (TNF)
   04612 Antigen processing and presentation
    102958919 (TNF)
   04660 T cell receptor signaling pathway
    102958919 (TNF)
   04657 IL-17 signaling pathway
    102958919 (TNF)
   04664 Fc epsilon RI signaling pathway
    102958919 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102958919 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102958919 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102958919 (TNF)
  09163 Immune disease
   05310 Asthma
    102958919 (TNF)
   05322 Systemic lupus erythematosus
    102958919 (TNF)
   05323 Rheumatoid arthritis
    102958919 (TNF)
   05321 Inflammatory bowel disease
    102958919 (TNF)
   05330 Allograft rejection
    102958919 (TNF)
   05332 Graft-versus-host disease
    102958919 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102958919 (TNF)
   05014 Amyotrophic lateral sclerosis
    102958919 (TNF)
   05020 Prion disease
    102958919 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    102958919 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102958919 (TNF)
   05410 Hypertrophic cardiomyopathy
    102958919 (TNF)
   05414 Dilated cardiomyopathy
    102958919 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102958919 (TNF)
   04940 Type I diabetes mellitus
    102958919 (TNF)
   04932 Non-alcoholic fatty liver disease
    102958919 (TNF)
   04931 Insulin resistance
    102958919 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102958919 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102958919 (TNF)
   05135 Yersinia infection
    102958919 (TNF)
   05133 Pertussis
    102958919 (TNF)
   05134 Legionellosis
    102958919 (TNF)
   05152 Tuberculosis
    102958919 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102958919 (TNF)
   05170 Human immunodeficiency virus 1 infection
    102958919 (TNF)
   05161 Hepatitis B
    102958919 (TNF)
   05160 Hepatitis C
    102958919 (TNF)
   05171 Coronavirus disease - COVID-19
    102958919 (TNF)
   05164 Influenza A
    102958919 (TNF)
   05168 Herpes simplex virus 1 infection
    102958919 (TNF)
   05163 Human cytomegalovirus infection
    102958919 (TNF)
   05169 Epstein-Barr virus infection
    102958919 (TNF)
   05165 Human papillomavirus infection
    102958919 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102958919 (TNF)
   05144 Malaria
    102958919 (TNF)
   05145 Toxoplasmosis
    102958919 (TNF)
   05140 Leishmaniasis
    102958919 (TNF)
   05142 Chagas disease
    102958919 (TNF)
   05143 African trypanosomiasis
    102958919 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102958919 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102958919 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102958919 (TNF)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Tumor necrosis fators
   102958919 (TNF)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Cytokines
   102958919 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 102958919
NCBI-ProteinID: XP_007098870
LinkDB
Position
Un
AA seq 306 aa
MQLSAHPVSRSFLSEDTRGPARRETEATPDPPGNNISDDTPPDKQPGDSLPLTHTALGLY
HHPAGLEPPGKNAMSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTL
FCLLHFGVIGPQREELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQWLSR
RANALLANGVELTDNQLKVPSDGLYLIYSQVLFTGQGCPSTHVLLTHTISRFAVSYQTKV
NLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVY
FGIIAL
NT seq 921 nt   +upstreamnt  +downstreamnt
atgcagctgtctgcacacccagtcagcagaagcttcctcagcgaagacaccaggggacca
gccaggagagagacagaagcaactccagacccccccggaaataacatctcagacgacaca
cccccagacaagcagccaggcgattctctccctctcacacacactgccttagggctctac
catcacccagctggacttgagccccctgggaagaacgccatgagcactgaaagcatgatc
cgggacgtggagctggccgaggaggcactccccaagaaggcagggggcccccagggctcc
agaaggtgcttgtgcctcagcctcttctccttcctcctcgtcgcaggagccaccacactc
ttctgcctgctgcactttggagtgatcggcccccagagggaagagctcccacatggcctg
caactaatcaaccctctgccccagacactcagatcatcttctcgaactccgagtgacaag
ccagtagcccatgtagtagcaaaccccgaagctgaagggcaactccagtggctgagccgg
cgtgccaatgccctcctggccaatggcgtggagctgacagacaaccagctgaaggtgccc
tcagacgggctgtacctcatctactcccaggtcctcttcacgggccaaggatgtccttcc
acacatgtgctcctcacccacaccatcagccgctttgccgtttcctaccagaccaaggtc
aacctcctctctgccatcaagagcccttgccagagggagaccccagagggggctgaggcc
aagccctggtatgagcccatctacctgggaggggtcttccaactggagaagggtgatcga
ctcagcgctgagatcaatctgcctgactatcttgactttgccgagtctgggcaagtctac
tttggaatcattgccctgtga

DBGET integrated database retrieval system