KEGG   Panthera tigris altaica (Amur tiger): 102958923
Entry
102958923         CDS       T02988                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04115  p53 signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102958923 (PMAIP1)
   04215 Apoptosis - multiple species
    102958923 (PMAIP1)
   04115 p53 signaling pathway
    102958923 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102958923 (PMAIP1)
   05203 Viral carcinogenesis
    102958923 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102958923 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102958923 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 102958923
NCBI-ProteinID: XP_015392308
LinkDB
Position
Un
AA seq 100 aa
MSHTVLTYVVCVLSNLSHVQKMGVHRAKVDINASLDAHSACPSDGALAGYSLSCQHDFDG
LLSFSEPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
NT seq 303 nt   +upstreamnt  +downstreamnt
atgagtcacaccgtgttaacatatgtcgtgtgtgttctaagtaacctttctcacgttcag
aaaatgggtgtgcatagagctaaagttgacataaacgcttcactggatgcacactccgct
tgcccctcggatggggctcttgccggttacagtttgtcatgtcagcatgattttgatggt
ttgctttccttttcagagcccgaagtggaatgtgccatgcagctccggagatttggagac
aaactgaatttccgacagaagcttatgaatctgatatccaaactcttccgctcgggaacc
tga

DBGET integrated database retrieval system