KEGG   Panthera tigris altaica (Amur tiger): 102958953Help
Entry
102958953         CDS       T02988                                 

Gene name
ZNF185
Definition
(RefSeq) zinc finger protein 185 (LIM domain)
Organism
ptg  Panthera tigris altaica (Amur tiger)
SSDB OrthologParalogGFIT
Motif
Pfam: LIM
Motif
Other DBs
NCBI-GeneID: 102958953
NCBI-ProteinID: XP_015396074
LinkDB All DBs
Position
Un
AA seq 686 aa AA seqDB search
MSISALGGSTKGKPLLPGEEERNNVLKQMKVRTTLKGDKSWITKQDESEGHTLELPSGRS
RATSFSSAGEVPKTRPPSTRAPTGYIIRGVFTKPIDSSCQPQRQFPKANGDPKSAAGLLR
AAPSGLPRPSSSGYKMTTEDYKKLAPYNVRRSSASGDAEEEEVPFSSDEQKRRSEAASSV
VRKTASREHSYVLSAAKKSTSSPAQEMQAPFIAKRVEVVDEDRPSEKSQDPPALGRSSPG
SSSVDGNRAKVSRGIWIEHMLTLPSPGRSWEPSTRGEEVVHLQIMTPGAGLRLMTSDLEG
MRSSLGSKYKEDPSPREAKKDLAGEEACKGPNLDLRSSAQSSDGNVGSRAMGFPPEGLIE
VDIDSGRGGSSSTLASAGPADQKSDSPADLEDKDAYSKGTLADSESAKNVAAKVGETWQE
RPAVLRGGHGDPAAPSQQSAAPRTPEQQSISKRPEQLVELDSQASSTLADSEDKNVAAEV
GETWQERPAVLRGGHGDPAAPSQQSAAPRTPEQQSSPRRPEELVELGSHTSRVKNPSSCM
VTVTTTPSTEQPHVYIPASPSELDSISTSKGILFMKEYMNASEVSSGKPVSSCYDSIRSI
EDSCDVEKKPACDSSLYSERTTGGICTYCNQEIRDCPKITLEHLGICCHDYCFKCGICSK
PMGELLDQIFIHHDTIHCGKCYEKLF
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgagtatctcagctcttggaggcagcaccaaagggaaaccactactaccaggtgaggag
gaacgcaataatgtcctcaagcagatgaaggttcggaccacgctgaagggggacaagagc
tggatcaccaagcaggatgaatcagagggccacaccctagagctgccttctggtcggagt
cgagctacatccttttcatcagctggggaagtcccgaagaccaggcctccaagcacaagg
gctcccactggctatatcatccggggagtgttcaccaagcccatagacagctcgtgtcag
ccacagcggcagttccccaaggccaatggagatccaaaaagtgctgctggtctgctgaga
gcagctcccagtgggcttccccggccctcctcctccggctataagatgaccactgaggat
tacaagaagctggcaccctacaatgtcagacgcagctcagcatcaggggatgctgaagag
gaggaggttcccttctcatctgatgagcagaaacggaggtcagaggctgcaagcagtgtg
gtgaggaagacagcctcccgggagcactcctatgttctgtcagcagccaagaagagcacc
agcagccctgcccaggagatgcaggctccattcattgcaaagagggttgaggtggtggat
gaggacaggccttctgagaagagccaggacccacctgctctaggaagatcctctcctggc
tcaagcagtgtggatggaaacagagccaaagtgtctcgggggatttggattgagcacatg
ctgactctgcccagccctggcaggagctgggagcccagtacaagaggtgaggaagttgtc
cacctgcagatcatgacacctggggcaggactccgcctgatgacctcagacctggaagga
atgaggtcttccctgggctccaaatacaaggaggaccccagtcctagagaggccaagaaa
gacttggctggtgaggaggcctgcaagggccccaatctagacctaaggtcaagtgcacag
tcaagtgatggcaatgtgggatccagagccatgggcttcccacctgaaggcttgattgaa
gtagacattgactctgggagaggaggctccagctccactttggcctctgctggaccagct
gaccagaagagtgacagtccagcagacctggaggacaaggatgcatactcaaagggcacc
ttggctgattctgaatcagccaagaatgtggctgccaaggtgggagagacctggcaggag
aggcctgcagtcctgagaggtggccacggggacccagctgcaccctcccagcagtctgca
gcccccaggaccccagagcagcagagcatctccaaaagaccagagcagcttgtggaactg
gacagccaggccagcagcaccttggctgattctgaagacaagaatgtggctgccgaagtg
ggagagacatggcaggagaggcctgcagtcctgagaggtggccacggggacccagctgca
ccctcccagcagtctgcagcccccagaaccccagagcagcagagcagccccagaagacca
gaggagcttgtagaactgggaagccacaccagcagggtgaaaaacccctcaagctgtatg
gtcactgttaccactactccttctactgagcagcctcatgtttacatcccagcctcccca
agtgaattggactccatttcaaccagcaaagggattctcttcatgaaggaatacatgaat
gctagtgaggtatcctctgggaagccagtgtcttcatgctatgacagcattagaagcatt
gaagactcgtgtgacgtggagaagaaacctgcatgtgacagctctctgtactctgagaga
acaactggagggatctgtacttactgcaaccaggagatcagagactgtccaaagattacc
ctagagcatcttggcatctgctgccatgattattgctttaagtgtgggatttgcagtaaa
ccaatgggtgagctcctggatcaaatcttcattcaccatgacaccatccactgtgggaaa
tgctatgagaagctcttctag

DBGET integrated database retrieval system