KEGG   Panthera tigris altaica (Amur tiger): 102959256
Entry
102959256         CDS       T02988                                 

Gene name
SLC31A1
Definition
(RefSeq) solute carrier family 31 member 1
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    102959256 (SLC31A1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102959256 (SLC31A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptg02000]
    102959256 (SLC31A1)
Transporters [BR:ptg02000]
 Solute carrier family (SLC)
  SLC31: Copper transporter
   102959256 (SLC31A1)
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 102959256
NCBI-ProteinID: XP_015398566
LinkDB
Position
Un
AA seq 180 aa
MADNSTTVPPHHHHHPTTSAHHSHGGGMDGMMMSMTFYFGFKNVELLFSGLVINTAGEMA
GAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSF
PHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH
NT seq 543 nt   +upstreamnt  +downstreamnt
atggctgacaacagtacaacggtgcctcctcaccaccaccaccacccgactacttcagcc
caccactctcatggcgggggaatggacggtatgatgatgtctatgaccttctactttggc
tttaagaatgtggaactgttattttctggtttggtgatcaatacagctggagaaatggcg
ggagctttcgtggcagtgtttttactagcaatgttctatgaaggactcaagatagcccga
gagagcctactgcgtaagtcacaagtcagcatccgctacaattccatgcctgtcccagga
ccaaatggaaccatccttatggagacacacaaaactgttgggcaacagatgctgagcttt
ccccacctcctgcagacagtgctgcatatcatccaagtggtcatcagctacttcctcatg
ctcatcttcatgacctacaacgggtacctctgcattgcagtagcagcgggggctggcaca
ggatactttctcttcagctggaagaaggcagtggtggtggacatcacagagcattgccat
tag

DBGET integrated database retrieval system