KEGG   Panthera tigris altaica (Amur tiger): 102959485
Entry
102959485         CDS       T02988                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00562  Inositol phosphate metabolism
ptg01100  Metabolic pathways
ptg04015  Rap1 signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04062  Chemokine signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04270  Vascular smooth muscle contraction
ptg04310  Wnt signaling pathway
ptg04371  Apelin signaling pathway
ptg04540  Gap junction
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04621  NOD-like receptor signaling pathway
ptg04713  Circadian entrainment
ptg04720  Long-term potentiation
ptg04723  Retrograde endocannabinoid signaling
ptg04724  Glutamatergic synapse
ptg04725  Cholinergic synapse
ptg04726  Serotonergic synapse
ptg04728  Dopaminergic synapse
ptg04730  Long-term depression
ptg04742  Taste transduction
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04911  Insulin secretion
ptg04912  GnRH signaling pathway
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04918  Thyroid hormone synthesis
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04924  Renin secretion
ptg04925  Aldosterone synthesis and secretion
ptg04926  Relaxin signaling pathway
ptg04927  Cortisol synthesis and secretion
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04929  GnRH secretion
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg04961  Endocrine and other factor-regulated calcium reabsorption
ptg04970  Salivary secretion
ptg04971  Gastric acid secretion
ptg04972  Pancreatic secretion
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05146  Amoebiasis
ptg05163  Human cytomegalovirus infection
ptg05200  Pathways in cancer
Module
ptg_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102959485 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102959485 (PLCB2)
   04310 Wnt signaling pathway
    102959485 (PLCB2)
   04371 Apelin signaling pathway
    102959485 (PLCB2)
   04020 Calcium signaling pathway
    102959485 (PLCB2)
   04070 Phosphatidylinositol signaling system
    102959485 (PLCB2)
   04072 Phospholipase D signaling pathway
    102959485 (PLCB2)
   04071 Sphingolipid signaling pathway
    102959485 (PLCB2)
   04022 cGMP-PKG signaling pathway
    102959485 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102959485 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102959485 (PLCB2)
   04613  Neutrophil extracellular trap formation
    102959485 (PLCB2)
   04621 NOD-like receptor signaling pathway
    102959485 (PLCB2)
   04062 Chemokine signaling pathway
    102959485 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    102959485 (PLCB2)
   04922 Glucagon signaling pathway
    102959485 (PLCB2)
   04929 GnRH secretion
    102959485 (PLCB2)
   04912 GnRH signaling pathway
    102959485 (PLCB2)
   04915 Estrogen signaling pathway
    102959485 (PLCB2)
   04921 Oxytocin signaling pathway
    102959485 (PLCB2)
   04926 Relaxin signaling pathway
    102959485 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    102959485 (PLCB2)
   04918 Thyroid hormone synthesis
    102959485 (PLCB2)
   04919 Thyroid hormone signaling pathway
    102959485 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    102959485 (PLCB2)
   04916 Melanogenesis
    102959485 (PLCB2)
   04924 Renin secretion
    102959485 (PLCB2)
   04925 Aldosterone synthesis and secretion
    102959485 (PLCB2)
   04927 Cortisol synthesis and secretion
    102959485 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102959485 (PLCB2)
   04270 Vascular smooth muscle contraction
    102959485 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    102959485 (PLCB2)
   04971 Gastric acid secretion
    102959485 (PLCB2)
   04972 Pancreatic secretion
    102959485 (PLCB2)
   04973 Carbohydrate digestion and absorption
    102959485 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102959485 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102959485 (PLCB2)
   04725 Cholinergic synapse
    102959485 (PLCB2)
   04728 Dopaminergic synapse
    102959485 (PLCB2)
   04726 Serotonergic synapse
    102959485 (PLCB2)
   04720 Long-term potentiation
    102959485 (PLCB2)
   04730 Long-term depression
    102959485 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    102959485 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    102959485 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    102959485 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102959485 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102959485 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102959485 (PLCB2)
   05016 Huntington disease
    102959485 (PLCB2)
   05017 Spinocerebellar ataxia
    102959485 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    102959485 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102959485 (PLCB2)
   04934 Cushing syndrome
    102959485 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102959485 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102959485 (PLCB2)
   05142 Chagas disease
    102959485 (PLCB2)
   05143 African trypanosomiasis
    102959485 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102959485 (PLCB2)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102959485 (PLCB2)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102959485 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102959485 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 Lectin_N AAA_13 Gp58
Other DBs
NCBI-GeneID: 102959485
NCBI-ProteinID: XP_015392826
LinkDB
Position
Un
AA seq 1099 aa
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEIEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGQNWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPAXXPA
DRKRVEAALSSCHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYM
TKEHLTKFINQKQRDSRLNSLLFPPARPDQVRGLIDKYEPSAINVQRGQLSPEGMVWFLC
GPENSVLAQDKLILYQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCV
ELDCWKGRPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQ
QAKMAEYCRTMFGDMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNQFSGPASPSKE
PGGEAEGDCPPSASVGEGTAWAGEEGTEPEEEEVEEEEESGSLNEEEIKKMQSDEGTAGL
EVTAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKR
QMSRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKH
EFMRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRY
RTKLSPSANSINPVWKEEPFVFEKILMPELASLRVAVMEEGNRFLGHRIIPINALNSGYH
HLCLHSESNMALTMPALFVFLEMKDYVPDTWADLTVALANPIKFFSAHDKKSVKLKEAIG
VLPEKPFPPGSPVAGHVNGALAPLSNGSAAHAVALAAAGARAREEAVKEAAEPAQELKDR
LELELLQQGEERYECILKRKEQHVAEQIAKMMELAREKQAAELKTLKETLETDTKEMKKK
LEAKRIERIQAMVKVTSDKMAQERLKREINNSHIQEVVQTIKQMTENLEKHQEKLEEKQA
ACLEQIREMEKQFQQEALAEYEARMKGLEAEVKESVRTCLRDCFPSEAKDKPERSFGAFK
ELCEQDPLTAKADAQESCL
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcttatctgagccaaggg
gagcgcttcatcaaatgggacgatgaaaccacaatagcctccccggttatcctccgcgtg
gatcccaagggctactacttatattggacatatcagagtaaggagatagagtttctggat
atcaccagtatcagggatactcgctttgggaagtttgccaagatacccaagagccagaag
ctccgggatgtcttcaacatggactttcctgacaacaacttcctgctaaagacgctcact
gtggtgtctggccctgacatggtggacctcaccttccacaactttgtctcctacaaggag
aacgtgggccagaactgggctgaagatgtactggctctggtcaagcatccgctgacagcc
aatgcctctcgcagcaccttcctggacaaaatcctggtaaagctcaagatgcagctcaat
cccgaagggaagattcctgtgaagaattttttccagatgtttcctgctgnnnnncctgct
gaccgcaagcgggtggaagctgccctcagctcctgccacctccccaaaggcaagaatgat
gccatcaatcctgaggacttcccagaatccgtctacaagagtttcctcatgagcctctgt
cctcggccagaaatagatgagatcttcacttcctaccatgccaaggccaagccctacatg
accaaggagcacctgaccaaattcatcaaccagaaacagagggactcccgcctcaactct
ttgctgtttccgcccgcccggcctgaccaagtgcggggcctcatcgacaagtacgagccc
agtgcaatcaacgtgcagaggggccagctgtcacctgagggcatggtgtggtttctctgt
gggccagagaacagtgtgctggcccaggacaagctgatactctaccaagacatgacacag
ccactcaaccattacttcatcaactcctcacacaacacctacctgacagctggccagttc
tctggcctttcctcggcagagatgtaccgccaggtgctgctggctggctgtcgctgcgtg
gagctggactgctggaagggcaggccccctgacgaggagcccatcatcacccacggcttt
accatgaccacagacatctatttcaaggaagcaattgaagccattgcagaaagtgctttt
aagacctccccctatcctgtcatcctgtcatttgaaaaccatgtggactcaccccgccaa
caggccaagatggctgagtattgccggacgatgtttggggacatgctactcacagagccc
ctggaaaagttcccactgaaaccaggcatccccctgcccagccccgaggatctccgaggc
aagatcctcatcaagaacaaaaagaaccagttttctggcccagcatcccccagcaaggag
ccgggtggggaggctgagggcgactgcccacccagtgcctctgtgggtgagggcacagcg
tgggctggtgaagaaggaacagagccggaggaggaagaggtggaagaggaggaggagtcg
ggaagcctgaatgaggaagagatcaagaagatgcagtcggacgagggcacagcgggcctg
gaggtgacagcttatgaggagatgtccagcctagtgaattacattcaacccaccaagttc
atctcctttgagttctctgcccagaagaaccgaagttatgtcatctcctccttcacagag
ctcaaggcttatgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgc
cagatgagccgcatttaccctaagggcacccgcatggactcctccaactacatgccccag
atgttctggaatgctggttgccagatggttgccctcaacttccagacgatggacctgccc
atgcagcagaacatggcgctgtttgagttcaatgggcagagtggctacctcctcaagcat
gagttcatgcgccggccagacaagcagttcaaccccttctcagtggaccgcatcgatgtg
gtggtagccaccaccctctccattacggtgatctctggccagttcctgtcagaacgcagt
gtgcgcacctatgtcgaagtggagctgtttggccttcctggggaccccaagaggcgctat
cgcaccaagctgtcacccagtgccaactctatcaatcctgtctggaaggaggagcccttt
gtctttgagaagatcttgatgcctgagctggcctccctcagggtggctgtaatggaggaa
ggcaacagatttcttggacaccgcatcatccccattaatgccctgaattctggctaccac
catctatgcctgcacagcgagagcaacatggcccttaccatgcctgcgctttttgtcttc
ctggagatgaaggactatgtacctgacacctgggcagatctcaccgtggctcttgccaat
cccatcaagttcttcagtgcccacgataagaagtctgtgaagctcaaggaagccatagga
gttctgcctgagaaacccttcccacccgggagtccagtcgccggccacgtcaatggggca
ctggccccactgagcaacgggtctgcagcccacgctgtggctcttgcagcagccggggcc
agggccagggaggaggccgtgaaagaagctgcggagccagcgcaggagctgaaggaccgc
ctggagctggagctgctgcagcagggcgaggagcggtacgagtgcatcctgaagcgcaag
gagcagcacgtggccgagcaaatcgccaagatgatggagctggccagagagaagcaggct
gcggaattgaagaccctcaaggagaccttggagactgataccaaagagatgaagaaaaag
ctggaggccaagaggatagagcggatccaggccatggtcaaagtcacctcggacaagatg
gctcaagaaaggctgaagagagagattaacaactctcacattcaggaggtggtgcaaacc
atcaagcagatgacagagaacctggagaagcaccaggagaagctggaagagaagcaggca
gcttgcctggagcagatccgggagatggaaaagcagttccagcaggaggcactggcagag
tacgaggccaggatgaaaggcttggaggccgaggtgaaggagtcagtgaggacctgcctc
agggactgcttcccctctgaggccaaggacaagcctgagagatcctttggggccttcaag
gagctgtgtgagcaggacccactcacagcaaaggcagatgcccaggagagttgcctctga

KEGG   Panthera tigris altaica (Amur tiger): 102960646
Entry
102960646         CDS       T02988                                 

Gene name
PLCB4
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00562  Inositol phosphate metabolism
ptg01100  Metabolic pathways
ptg04015  Rap1 signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04062  Chemokine signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04270  Vascular smooth muscle contraction
ptg04310  Wnt signaling pathway
ptg04371  Apelin signaling pathway
ptg04540  Gap junction
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04621  NOD-like receptor signaling pathway
ptg04713  Circadian entrainment
ptg04720  Long-term potentiation
ptg04723  Retrograde endocannabinoid signaling
ptg04724  Glutamatergic synapse
ptg04725  Cholinergic synapse
ptg04726  Serotonergic synapse
ptg04728  Dopaminergic synapse
ptg04730  Long-term depression
ptg04742  Taste transduction
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04911  Insulin secretion
ptg04912  GnRH signaling pathway
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04918  Thyroid hormone synthesis
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04924  Renin secretion
ptg04925  Aldosterone synthesis and secretion
ptg04926  Relaxin signaling pathway
ptg04927  Cortisol synthesis and secretion
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04929  GnRH secretion
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg04961  Endocrine and other factor-regulated calcium reabsorption
ptg04970  Salivary secretion
ptg04971  Gastric acid secretion
ptg04972  Pancreatic secretion
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05146  Amoebiasis
ptg05163  Human cytomegalovirus infection
ptg05200  Pathways in cancer
Module
ptg_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102960646 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102960646 (PLCB4)
   04310 Wnt signaling pathway
    102960646 (PLCB4)
   04371 Apelin signaling pathway
    102960646 (PLCB4)
   04020 Calcium signaling pathway
    102960646 (PLCB4)
   04070 Phosphatidylinositol signaling system
    102960646 (PLCB4)
   04072 Phospholipase D signaling pathway
    102960646 (PLCB4)
   04071 Sphingolipid signaling pathway
    102960646 (PLCB4)
   04022 cGMP-PKG signaling pathway
    102960646 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102960646 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102960646 (PLCB4)
   04613  Neutrophil extracellular trap formation
    102960646 (PLCB4)
   04621 NOD-like receptor signaling pathway
    102960646 (PLCB4)
   04062 Chemokine signaling pathway
    102960646 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    102960646 (PLCB4)
   04922 Glucagon signaling pathway
    102960646 (PLCB4)
   04929 GnRH secretion
    102960646 (PLCB4)
   04912 GnRH signaling pathway
    102960646 (PLCB4)
   04915 Estrogen signaling pathway
    102960646 (PLCB4)
   04921 Oxytocin signaling pathway
    102960646 (PLCB4)
   04926 Relaxin signaling pathway
    102960646 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    102960646 (PLCB4)
   04918 Thyroid hormone synthesis
    102960646 (PLCB4)
   04919 Thyroid hormone signaling pathway
    102960646 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    102960646 (PLCB4)
   04916 Melanogenesis
    102960646 (PLCB4)
   04924 Renin secretion
    102960646 (PLCB4)
   04925 Aldosterone synthesis and secretion
    102960646 (PLCB4)
   04927 Cortisol synthesis and secretion
    102960646 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102960646 (PLCB4)
   04270 Vascular smooth muscle contraction
    102960646 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    102960646 (PLCB4)
   04971 Gastric acid secretion
    102960646 (PLCB4)
   04972 Pancreatic secretion
    102960646 (PLCB4)
   04973 Carbohydrate digestion and absorption
    102960646 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102960646 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102960646 (PLCB4)
   04725 Cholinergic synapse
    102960646 (PLCB4)
   04728 Dopaminergic synapse
    102960646 (PLCB4)
   04726 Serotonergic synapse
    102960646 (PLCB4)
   04720 Long-term potentiation
    102960646 (PLCB4)
   04730 Long-term depression
    102960646 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    102960646 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    102960646 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    102960646 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102960646 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102960646 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102960646 (PLCB4)
   05016 Huntington disease
    102960646 (PLCB4)
   05017 Spinocerebellar ataxia
    102960646 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    102960646 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102960646 (PLCB4)
   04934 Cushing syndrome
    102960646 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102960646 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102960646 (PLCB4)
   05142 Chagas disease
    102960646 (PLCB4)
   05143 African trypanosomiasis
    102960646 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102960646 (PLCB4)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102960646 (PLCB4)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102960646 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102960646 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 102960646
NCBI-ProteinID: XP_007086882
LinkDB
Position
Un
AA seq 1206 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSIRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVNILEDDNEEEIESADQEEEAHPEYKFGSELSADDLGHKEAVANSVKKASD
DLEHEINKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNRLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTAALGSGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLFMK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEVGSRDGPQTSNSSV
KLQNAN
NT seq 3621 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcaaaaggaagttccttcctttttgcaagaagga
gccgtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgaatttggcttctttctgacctggagaagtgaaggcaaggaaggacaagttcta
gaatgctccctcatcaacagtattcgattgggagccaccccaaaggatcccaaaatcctg
gctgctcttgaagctgttggaaagtcagagaatgatctggaagggcgaatagtttgtgtc
tgcagtggcacagatctggtgaacatcagtttcacatacatggtggctgaaaatccggaa
gtaactaagcaatgggtagaaggactgagatcaatcatacacaacttcagggccaacaat
gtcagtccaatgacctgcctcaaaaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacctttgcatcgggaaaaacagaaaag
gttatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaatcgag
cctgcagcatttacttatgaaaagttctatgaactgacacaaaagatttgtcctcgaaca
gatatagaggatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcagcgagaccctcgactgaatgaaattttgttc
ccattttatgatgctaaaagggcaatgcagatcatcgagatgtatgagcctgatgaagat
ttgaagaaaaaaggcctcatatcaagcgatgggttttgcagatacctgatgtcagatgaa
aatgcccctgtcttcctggatcgtttagaactttaccaagaaatggaccatcctctggcc
cactacttcatcagttcttcccataacacctatctcactggccgacagtttggtggaaag
tcttccgtagaaatgtacagacaggttctcctggctggttgcaggtgtgttgaacttgac
tgttgggatggaaaaggtgaagaccaggaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgttattcaagccatcaaggaaactgcgtttgtcacatcc
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccactcgaaccaggcaggcccttaccatcccccaatgacctcaaaagaaaaatactcatc
aaaaataagcggctgaaacctgaggtcgaaaaaaaacagcttgaagctttgaaaagcatg
atggaagctggagaatctgctgccccggttaacatcttagaggatgataatgaagaagaa
atagagagtgctgaccaagaggaggaagctcaccctgaatacaaatttggaagtgaactt
tctgctgatgacttgggtcacaaggaggctgttgcaaatagtgtcaagaaggcttcagat
gaccttgaacatgaaatcaacaaaaagggcctggttactgtagaagatgaacaggcatgg
atggcatcttataaatatgtaggtgctaccactaatatccatccatatttgtctacaatg
atcaactatgcacagcccgtaaaatttcaaggtttccatgtggctgaagagcgcaatatt
cattataacatgtcttcttttaatgagtccgttggtctaggctacttgaagacacacgcg
attgaatttgtgaattacaacaaacggcaaatgagccgcatttaccccaagggaggccgg
gtcgattccagtaattacatgcctcagattttctggaacgctggctgccagatggtttcg
ctcaactatcagaccccagatttagcgatgcaattgaatcagggaaaatttgagtataat
ggatcatgcgggtaccttctcaaaccagacttcatgagacggcccgatcgaacatttgat
cccttctctgaaactcctgtcgacggggttattgcagccacttgctcagtgcaggtcata
tcaggtcagtttttatcagataagaaaattggtacatatgtagaagtggatatgtatggt
ttacccactgacaccatacgtaaggaattccgaactcgcatggtgatgaacaatggactc
aatccagtttacaatgaagaatcatttgtgtttcggaaggtgatcctccctgacctggca
gtcttgagaatagctgtgtatgacgacaacaataggctgataggccagaggattcttccg
ctggatggcctccaagcaggttatcgacacatttctcttcgaaatgagggaaataaacca
ttatcactgccaacaattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatattgtggatgctttatcagatccaaagaaatttctttccattacggaaaagaga
gcagaccaaatgagagctatgggcattgaaactagtgacatagcagatgtgcccagtgat
acttctaagaatgacaagaaaggaaaggccaacactgccaaagcaaacgtgaccccgcag
agcagctctgagctcagaccaaccaccacggcggccctggggtctggagtggaagccaag
aaaggtatcgaacttatccctcaagtgaggatagaagatttaaagcagatgaaggcttac
ttgaagcatttaaagaaacaacagaaggagctaaattctttaaagaagaaacatgctaag
gagcacagcaccatgcagaagctgcattgcacacaagttgacaaaattgtggcacagtat
gacaaagagaagtcgacgcatgagaaaatcctagagaaggcaatgaagaagaagggggga
agtaattgtctcgaaatgaaaaaagaaacagaaattaaaattcagacactgacatcagat
cacaaatctaaggtcaaagagatagtggcccagcacacaaaggaatggtcagaaatgatt
aacacccacagtgctgaggaacaagaaatccgggacctgcacctcagccagcagtgcgag
ctcctgagaaagctactgatcaacgcccacgagcagcaaacccagcagctaaaactgtcc
catgacagggaaagcaaggaaatgcgagcacaccaggctaagatttctatggaaaatagc
aaagccatcagccaagataaatctatcaagaataaagcagaacgggaaaggagagtcagg
gagttaaatagcagcaacaccaaaaagtttctggaagaaagaaagagactcttcatgaaa
cagtccaaagaaatggatcagttgaaaaaagtccagcttgaacacctggagttcctagag
aaacagaatgagcagctattgaaatcctgccatgcagtgtcccaaacgcaaggcgaagga
gatgcagcagatggtgaagttggaagccgagatggaccgcagaccagcaacagtagtgtg
aaactccagaatgcaaactga

KEGG   Panthera tigris altaica (Amur tiger): 102961121
Entry
102961121         CDS       T02988                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00562  Inositol phosphate metabolism
ptg01100  Metabolic pathways
ptg04015  Rap1 signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04062  Chemokine signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04270  Vascular smooth muscle contraction
ptg04310  Wnt signaling pathway
ptg04371  Apelin signaling pathway
ptg04540  Gap junction
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04621  NOD-like receptor signaling pathway
ptg04713  Circadian entrainment
ptg04720  Long-term potentiation
ptg04723  Retrograde endocannabinoid signaling
ptg04724  Glutamatergic synapse
ptg04725  Cholinergic synapse
ptg04726  Serotonergic synapse
ptg04728  Dopaminergic synapse
ptg04730  Long-term depression
ptg04742  Taste transduction
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04911  Insulin secretion
ptg04912  GnRH signaling pathway
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04918  Thyroid hormone synthesis
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04924  Renin secretion
ptg04925  Aldosterone synthesis and secretion
ptg04926  Relaxin signaling pathway
ptg04927  Cortisol synthesis and secretion
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04929  GnRH secretion
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg04961  Endocrine and other factor-regulated calcium reabsorption
ptg04970  Salivary secretion
ptg04971  Gastric acid secretion
ptg04972  Pancreatic secretion
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05146  Amoebiasis
ptg05163  Human cytomegalovirus infection
ptg05200  Pathways in cancer
Module
ptg_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102961121 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102961121 (PLCB1)
   04310 Wnt signaling pathway
    102961121 (PLCB1)
   04371 Apelin signaling pathway
    102961121 (PLCB1)
   04020 Calcium signaling pathway
    102961121 (PLCB1)
   04070 Phosphatidylinositol signaling system
    102961121 (PLCB1)
   04072 Phospholipase D signaling pathway
    102961121 (PLCB1)
   04071 Sphingolipid signaling pathway
    102961121 (PLCB1)
   04022 cGMP-PKG signaling pathway
    102961121 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102961121 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102961121 (PLCB1)
   04613  Neutrophil extracellular trap formation
    102961121 (PLCB1)
   04621 NOD-like receptor signaling pathway
    102961121 (PLCB1)
   04062 Chemokine signaling pathway
    102961121 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    102961121 (PLCB1)
   04922 Glucagon signaling pathway
    102961121 (PLCB1)
   04929 GnRH secretion
    102961121 (PLCB1)
   04912 GnRH signaling pathway
    102961121 (PLCB1)
   04915 Estrogen signaling pathway
    102961121 (PLCB1)
   04921 Oxytocin signaling pathway
    102961121 (PLCB1)
   04926 Relaxin signaling pathway
    102961121 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    102961121 (PLCB1)
   04918 Thyroid hormone synthesis
    102961121 (PLCB1)
   04919 Thyroid hormone signaling pathway
    102961121 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    102961121 (PLCB1)
   04916 Melanogenesis
    102961121 (PLCB1)
   04924 Renin secretion
    102961121 (PLCB1)
   04925 Aldosterone synthesis and secretion
    102961121 (PLCB1)
   04927 Cortisol synthesis and secretion
    102961121 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102961121 (PLCB1)
   04270 Vascular smooth muscle contraction
    102961121 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    102961121 (PLCB1)
   04971 Gastric acid secretion
    102961121 (PLCB1)
   04972 Pancreatic secretion
    102961121 (PLCB1)
   04973 Carbohydrate digestion and absorption
    102961121 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102961121 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102961121 (PLCB1)
   04725 Cholinergic synapse
    102961121 (PLCB1)
   04728 Dopaminergic synapse
    102961121 (PLCB1)
   04726 Serotonergic synapse
    102961121 (PLCB1)
   04720 Long-term potentiation
    102961121 (PLCB1)
   04730 Long-term depression
    102961121 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    102961121 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    102961121 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    102961121 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102961121 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102961121 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102961121 (PLCB1)
   05016 Huntington disease
    102961121 (PLCB1)
   05017 Spinocerebellar ataxia
    102961121 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102961121 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102961121 (PLCB1)
   04934 Cushing syndrome
    102961121 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102961121 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102961121 (PLCB1)
   05142 Chagas disease
    102961121 (PLCB1)
   05143 African trypanosomiasis
    102961121 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102961121 (PLCB1)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102961121 (PLCB1)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102961121 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102961121 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like PH_14 DUF1154
Other DBs
NCBI-GeneID: 102961121
NCBI-ProteinID: XP_015395086
LinkDB
Position
Un
AA seq 1115 aa
MITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKL
QVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCP
RPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPN
DSLAKKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLA
GNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFK
TSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYK
ILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCK
KSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFETSKKRNRSFEMSSFVETKGLEQLTK
SPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYE
YNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDM
FGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRI
LPVQAIRPGYHYICLRNERNQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLME
QRAKQLAALTLEDEEEVKKEADPGETPSEAPSEARTTPAENGVNHTTSLAPKPPSQAPHS
QPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKPFVKLQKKHYKEMKDLVKRHHKKT
TDLIKEHTTKYNEIQNDYLRRRAALEKTAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEM
TQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEIC
EKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQ
EKLVEKHKEIRQQILDEKPKLQMDLEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSS
APPSLASDPGKLNHRPPSSEELEGDNPGKEFDTPL
NT seq 3348 nt   +upstreamnt  +downstreamnt
atgataacggtggtgtacgggcctgacttagttaacatctcccatttgaatctcgtggct
ttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaacctg
ctggcccaaaacatgtccagagacgcatttctggaaaaagcctatacgaagcttaagctg
caagtcactccagaagggcgcattcctctcaaaaacatataccgcttgttctcagcagac
cggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgattca
atacctcaagaagatttcactccagaagtgtacagagttttcctgaacaacctttgccct
cgacctgaaattgataacatcttttctgaatttggtgccaaaagcaaaccataccttacg
gttgatcagatgatggattttatcaacctgaagcagcgagatcctcggctaaatgaaata
ctttacccacctttaaagcaagagcaagtccaagtactgattgagaagtatgagcctaac
gatagccttgccaaaaaaggacagatatcagtggatggctttatgcgctatctgagtgga
gaagaaaatggagtcgtttcgcctgagaaactggatttgaatgaagatatgtctcagccc
ctttctcactatttcatcaattcctcacacaacacctacctcacagctggccagttggct
ggaaattcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtggag
ttggactgctggaaaggacggactgcagaagaggaaccagtcatcacccatgggttcacc
atgacaactgaaatatccttcaaggaagtgatagaagcaattgctgagtgtgcatttaag
acgtcaccttttccaattctgctttcatttgagaaccacgtagattccccaaagcagcaa
gccaagatggcagagtattgccgactgatctttggagatgctcttctcatggaaccactg
gaaaaatacccactggaatctggagttcctcttccaagccctatggatttaatgtacaaa
attttggtgaaaaataagaagaaatcgcataagtcatcagaaggaagtggcaaaaagaag
ctctcagaacaagcctccaacacgtacagtgactcgtccagcgtgtttgagccctcatct
ccaggagccggggaagctgatactgagagtgacgacgatgatgatgatgacgactgtaaa
aaatcttcaatggacgagggtactgctggcagtgaggccatggccacagaagagatgtct
aacctggtgaactatattcagccagtcaagtttgagtcctttgaaacttcaaaaaaaaga
aatagaagttttgaaatgtcttccttcgtggaaaccaaaggacttgagcaactgacaaag
tctccagtggaatttgtagaatataacaaaatgcagctcagcaggatatatccaaaagga
acccgtgtggattcatccaactacatgcctcagctcttctggaatgctggttgccaaatg
gttgcacttaattttcaaactgtggacctggctatgcaaataaatatggggatgtatgaa
tacaatgggaaaagtggctacagattaaagccagagttcatgaggagacccgacaagcac
tttgatccattcaccgaaggcatcgtagatgggatagtggccaacactttatctgtgaag
attatttcaggtcagtttctttctgataagaaagttgggacctatgtggaagtggatatg
tttggtttgcctgtggacacaaggaggaaggcatttaagaccaaaacatcacaaggaaat
gctgtaaatcctgtctgggaagaagagcccattgtgttcaaaaaggtggttcttccttct
ctggcctgtttgaggatagcagtttatgaagaaggaggtaaatttatcggtcaccggatc
ttgcctgtacaggcaattcggccaggctatcactacatctgtctgcggaatgagaggaac
cagcctctgatgctcccagctgtctttgtctacatagaggtgaaagactatgtcccagat
acatatgcagatgtgattgaagctttgtcaaatccaatacgatatgtgaatctgatggag
cagagagcaaagcaactggctgctttgacactggaagatgaagaagaagtaaagaaagag
gctgatcctggggaaacaccatcagaagctccaagtgaagccaggacaactccagcagaa
aacggagtgaatcacactacatctctggcacccaaaccaccctcccaggctccccacagc
caaccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagtgtt
ttaacagaagtggaagcacagactatcgaagagctaaagcaacagaaaccgtttgtgaaa
cttcaaaagaagcactacaaagaaatgaaagacctggtgaaaagacaccacaagaaaacc
actgaccttatcaaagaacacactacaaaatataatgaaattcagaatgactacttgaga
aggagggcagctttggaaaagacagccaaaaaggatagtaagaaaaaatcagaacccagc
agtcctgaccatggttcatcaacaattgagcaagatcttgctgccctagatgctgaaatg
acccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgacaa
gaacagtattacagtgagaaataccagaagcgagaacatattaaactgcttattcagaaa
ttgacggatgttgccgaagaatgtcagaacaatcagctgaagaagctcaaagaaatctgt
gagaaggagaagaaggaattaaagaagaaaatggataaaaaaaggcaggagaagatcaca
gaagctaaatccaaagacaaaagtcaaatggaagaggaaaagacagagatgatccggtca
tacatccaggaggtggtacagtacatcaagaggttagaagaggcacaaagtaaacggcaa
gaaaaacttgtagagaaacacaaggagatccgtcagcagatcctggatgaaaagcccaag
ctgcagatggatctggagcaagagtaccaagacaagttcaaaaggctgcccctggagatc
ttggagttcgtgcaggaagccatgaaagggaagatcagtgaagacagcaatcacagttct
gcccctccctccctggcctcagaccctggaaaactgaaccacaggcctccttccagtgag
gagctagaaggggacaacccaggaaaagagtttgatactcctctgtga

KEGG   Panthera tigris altaica (Amur tiger): 102961437
Entry
102961437         CDS       T02988                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00562  Inositol phosphate metabolism
ptg01100  Metabolic pathways
ptg04015  Rap1 signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04062  Chemokine signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04270  Vascular smooth muscle contraction
ptg04310  Wnt signaling pathway
ptg04371  Apelin signaling pathway
ptg04540  Gap junction
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04621  NOD-like receptor signaling pathway
ptg04713  Circadian entrainment
ptg04720  Long-term potentiation
ptg04723  Retrograde endocannabinoid signaling
ptg04724  Glutamatergic synapse
ptg04725  Cholinergic synapse
ptg04726  Serotonergic synapse
ptg04728  Dopaminergic synapse
ptg04730  Long-term depression
ptg04742  Taste transduction
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04911  Insulin secretion
ptg04912  GnRH signaling pathway
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04918  Thyroid hormone synthesis
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04924  Renin secretion
ptg04925  Aldosterone synthesis and secretion
ptg04926  Relaxin signaling pathway
ptg04927  Cortisol synthesis and secretion
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04929  GnRH secretion
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg04961  Endocrine and other factor-regulated calcium reabsorption
ptg04970  Salivary secretion
ptg04971  Gastric acid secretion
ptg04972  Pancreatic secretion
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05146  Amoebiasis
ptg05163  Human cytomegalovirus infection
ptg05200  Pathways in cancer
Module
ptg_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102961437 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102961437 (PLCB3)
   04310 Wnt signaling pathway
    102961437 (PLCB3)
   04371 Apelin signaling pathway
    102961437 (PLCB3)
   04020 Calcium signaling pathway
    102961437 (PLCB3)
   04070 Phosphatidylinositol signaling system
    102961437 (PLCB3)
   04072 Phospholipase D signaling pathway
    102961437 (PLCB3)
   04071 Sphingolipid signaling pathway
    102961437 (PLCB3)
   04022 cGMP-PKG signaling pathway
    102961437 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102961437 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102961437 (PLCB3)
   04613  Neutrophil extracellular trap formation
    102961437 (PLCB3)
   04621 NOD-like receptor signaling pathway
    102961437 (PLCB3)
   04062 Chemokine signaling pathway
    102961437 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    102961437 (PLCB3)
   04922 Glucagon signaling pathway
    102961437 (PLCB3)
   04929 GnRH secretion
    102961437 (PLCB3)
   04912 GnRH signaling pathway
    102961437 (PLCB3)
   04915 Estrogen signaling pathway
    102961437 (PLCB3)
   04921 Oxytocin signaling pathway
    102961437 (PLCB3)
   04926 Relaxin signaling pathway
    102961437 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    102961437 (PLCB3)
   04918 Thyroid hormone synthesis
    102961437 (PLCB3)
   04919 Thyroid hormone signaling pathway
    102961437 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    102961437 (PLCB3)
   04916 Melanogenesis
    102961437 (PLCB3)
   04924 Renin secretion
    102961437 (PLCB3)
   04925 Aldosterone synthesis and secretion
    102961437 (PLCB3)
   04927 Cortisol synthesis and secretion
    102961437 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102961437 (PLCB3)
   04270 Vascular smooth muscle contraction
    102961437 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    102961437 (PLCB3)
   04971 Gastric acid secretion
    102961437 (PLCB3)
   04972 Pancreatic secretion
    102961437 (PLCB3)
   04973 Carbohydrate digestion and absorption
    102961437 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102961437 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102961437 (PLCB3)
   04725 Cholinergic synapse
    102961437 (PLCB3)
   04728 Dopaminergic synapse
    102961437 (PLCB3)
   04726 Serotonergic synapse
    102961437 (PLCB3)
   04720 Long-term potentiation
    102961437 (PLCB3)
   04730 Long-term depression
    102961437 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    102961437 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    102961437 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    102961437 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102961437 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102961437 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102961437 (PLCB3)
   05016 Huntington disease
    102961437 (PLCB3)
   05017 Spinocerebellar ataxia
    102961437 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    102961437 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102961437 (PLCB3)
   04934 Cushing syndrome
    102961437 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102961437 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102961437 (PLCB3)
   05142 Chagas disease
    102961437 (PLCB3)
   05143 African trypanosomiasis
    102961437 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102961437 (PLCB3)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102961437 (PLCB3)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102961437 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102961437 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y PH_14 PLC-beta_C EF-hand_like C2 BPL_N
Other DBs
NCBI-GeneID: 102961437
NCBI-ProteinID: XP_015397448
LinkDB
Position
Un
AA seq 1075 aa
MGVSKWQEHWGGWPEGVQGSSLGHSPHSLTPAFPSRPQEASSRNLVTLRVDPNGFFLYWT
GPNMEVDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNT
TFLNFMAVQDDTAKVWTEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNI
LKMFSADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGA
KGKPYLTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEG
FSRYLGGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTGEXATLGQLERWHXXLLW
GCRCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHV
DSAKQQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTG
VPNSSIRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCLGLSNGEELGLEKPSLEPRK
SLGEEGLQRGPDALGSADREDEEEDEEEEEQADPKKPTSDEVSPAGGKRQTQRVLIPQAF
AEHLLCARHSTVYWPPERNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTR
VDSSNYMPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFD
PFTEVIVDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFN
PVWDEEPFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPL
CLPALLIYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQVGPETCQ
ETPSQQPVTPNPTPSTLDISPRRPPGEHVFPATGAHTGSRHSDGTDGPRCWHNRHRPPSP
SPCDNLSVTQRGSSCRGGEDEKAEEEEVKRYREFQKRQVQSLLELREAQADTEAERRLEH
LRQAQQRLREIVLDAHATQFKRLKETNERCNGHAPGSGGHLSGADSESQEENTKL
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgggcgtcagcaaatggcaggagcactggggtggatggccggagggagtccagggatca
agcctcggccacagccctcactcactgacccctgccttcccgtcccgtccccaggaggct
tccagtcggaacctggtgaccctgcgtgtggaccccaatggcttcttcctgtactggaca
ggacccaacatggaggtggacaccctggacatcagttccatcagggacacgcggacggga
cgttatgcccgcctgcccaaggaccccaagatccgagaggtgctgggctttggaggccct
gacacccggctggaggagaagttgatgacagtggtggccgggccagacccggtgaataca
acattcttgaacttcatggccgtgcaggatgacacagccaaggtctggaccgaggagctg
ttcaagctggctatgaacatcctggctcagaacgcctcccggaacacctttctgagaaaa
gcatacaccaagctgaagctgcaggtgaaccaggatggacggatcccagtgaagaacatc
ctgaagatgttctcagcagataagaagcgcgtcgagactgcgctggaatcctgtggcctc
aatttcaaccggagtgagtccatccggcccgacgagttctccttggaaatcttcgagcgg
ttcctgaataagctgtgtctgcggccagacattgacaagatcctgctggagataggcgcc
aagggcaagccatacctgacgctggagcagctcatggacttcatcaaccagaagcaacgg
gacccgaggctcaacgaagtgctgtacccacccctgcggccctcccaggcccggctgctc
attgagaagtatgagcccaaccagcagttcctggaacgagaccagatgtccatggagggc
ttcagccgctacctggggggtgaggagaatggaatcctgcccttggaggccctggatctg
agcgcagacatgacccagccgctaagcgcctacttcatcaactcctcacacaacacctat
ctcacaggtgagtgagccaccctcgggcagctggagcggtggcatnnnnnactgctctgg
ggctgccgctgcgtggagctggacgtgtggaaagggcggcccccggaggaggagcccttt
atcacccacggcttcaccatgaccaccgaggtgccgctgcgagacgtgctcgaggccatt
gcggaaaccgccttcaagacctcgccctaccctgtcatcctctccttcgagaaccacgtg
gactcggcaaagcagcaggccaagatggccgagtactgtcgttcgatcttcggggacgcg
ctgctcatcgacccactggacaagtacccgctggccccaggcgtccccctgcccagcccc
caggacctgatgggccgcatcctggtgaagaacaagaagcgacaccagcccagcactggt
gtccccaacagctccattcgcaagcggccgctggagcagagcaactcggccctgagcgag
agctctgccgccaccgagccctcctcacctcagctcgggtcccccagctctgacagctgc
ctgggcctgagcaatggggaagagctgggccttgagaagcccagcctggagcctcggaag
tctctgggcgaggaggggctacagcggggccctgatgctcttggatctgccgaccgtgag
gatgaggaggaagacgaggaagaggaggaacaggcagatcccaaaaagccgacctcagat
gaggtcagtcccgcgggcgggaagaggcagacgcagcgtgttttaattccccaagcgttt
gctgaacacctactgtgtgccagacacagcactgtgtactggcccccagagaggaacaaa
tgcttcgagatgtcatccttcgtggaaaccaaggccatggagcaactgaccaagagcccc
atggagtttgtggaatacaataaacaacagctcagccgcatctaccccaagggcacccgc
gtggactcctccaattatatgccccagctcttctggaacgtgggctgccagcttgtggcc
ctcaactttcagaccctggatgtggcgatgcagctgaacgcgggtgtgtttgagtacaac
gggcgcagcggctacctgctcaagcccgagttcatgcggcggccggacaagtccttcgac
cccttcaccgaagtcatcgtggacggcatcgtggccaatgccttgcgggtcaaggtgatc
tcggggcagttcctgtccgacaggaaggtgggcatctacgtggaggtggacatgtttggc
ctccccgttgacacacggcgcaagtaccgcactcggacgtctcaggggaactcgttcaat
cctgtgtgggatgaggaaccctttgacttccccaaggtggtgctccccacgctggcttcg
ctgcgcatcgcggcctttgaggaaggcggcaagtttgtggggcatcggattctgcccgtc
tctgccatccgttcagggtaccactacatttgcctgcggaatgaggccaaccagccgctc
tgcctgccggccctgctcatatacaccgaagcctccgactatattcctgatgaccaccag
gactacgcagaggccctgatcaaccccatcaagcatgtcagcctgatggaccagagggcc
aagcagttggccgccctcatcggggagagcgaggctcaggttggcccagaaacctgccag
gagactccatctcagcagccggtgaccccaaaccccacacccagcacactggacatctcc
ccgcgccggcccccgggcgagcacgtatttccagcaaccggtgcccacacaggctcccgt
cattcggatggaactgatgggcctcgttgttggcataacagacaccgccctcccagcccg
agtccctgtgacaacctgagtgtcacccagaggggttcttcctgcagaggcggggaggac
gagaaggcggaggaggaagaggtgaagcggtatcgagagttccagaagagacaggtgcag
agtctgctggagctgcgggaggcccaggcggatacagaggccgagcggaggctggagcat
ctgcgacaggctcagcagaggctcagggagatcgtcctggatgctcacgcgacccagttc
aagcggctgaaggagacgaacgagaggtgcaatggtcacgcccctgggagcggcgggcac
ctgtctggcgccgactcagagagccaagaggagaatacgaagctctga

DBGET integrated database retrieval system