KEGG   Panthera tigris altaica (Amur tiger): 102959510
Entry
102959510         CDS       T02988                                 

Gene name
ITPA
Definition
(RefSeq) inosine triphosphatase
  KO
K01519  inosine triphosphate pyrophosphatase [EC:3.6.1.-]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102959510 (ITPA)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102959510 (ITPA)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     102959510 (ITPA)
SSDB
Motif
Pfam: Ham1p_like
Other DBs
NCBI-GeneID: 102959510
NCBI-ProteinID: XP_015390643
LinkDB
Position
Un
AA seq 209 aa
MRFGMAAPLAGKKIVFVTGNAKKLEEVIQILGDKFPCTLVAQKIDLPEYQGEPDEISIQK
CQEAARQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLRELRTWSAYALCTFAL
STGDPSEPVRLFRGRTSGRIVVPRGCRDFGWDPCFQPDGYEQTYAEMPKAEKNTISHRFR
ALLELQKYFGSLSPPVAGDSRPGGGSGEG
NT seq 630 nt   +upstreamnt  +downstreamnt
atgcggttcggcatggcggcccccttagccgggaagaagatcgtgtttgtcacggggaac
gccaagaagctggaggaggtcattcagattctgggagataagtttccgtgcactttggtg
gcacagaagattgacctgccagagtaccagggagagcctgatgagatttccatacagaag
tgtcaggaggcagctcgccaggtgcaggggcccgtactggtggaggacacctgtctgtgc
ttcaacgcccttgggggcctccctggcccctacataaagtggtttctggagaagttaaag
cctgaaggtctccgtgagctccggacgtggtcagcctatgcgctctgcacgtttgcactc
agcaccggggaccccagcgagccagtgcgcctgttcaggggccggacctcgggccggatt
gtggtgccccgaggctgccgggacttcggctgggatccttgttttcagcctgatggatac
gagcagacgtacgcagagatgcccaaagctgagaagaacaccatctcccatcgcttccgg
gccctgcttgagctgcagaaatactttggcagcctgagtcctccggtagctggtgacagt
cgccctggcgggggatctggggaaggctag

DBGET integrated database retrieval system