KEGG   Panthera tigris altaica (Amur tiger): 102959529
Entry
102959529         CDS       T02988                                 

Gene name
TLR4
Definition
(RefSeq) toll like receptor 4
  KO
K10160  toll-like receptor 4
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04064  NF-kappa B signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04145  Phagosome
ptg04151  PI3K-Akt signaling pathway
ptg04217  Necroptosis
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05162  Measles
ptg05164  Influenza A
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05205  Proteoglycans in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05321  Inflammatory bowel disease
ptg05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102959529 (TLR4)
   04066 HIF-1 signaling pathway
    102959529 (TLR4)
   04151 PI3K-Akt signaling pathway
    102959529 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102959529 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    102959529 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102959529 (TLR4)
   04620 Toll-like receptor signaling pathway
    102959529 (TLR4)
   04621 NOD-like receptor signaling pathway
    102959529 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102959529 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102959529 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102959529 (TLR4)
   05321 Inflammatory bowel disease
    102959529 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102959529 (TLR4)
   05135 Yersinia infection
    102959529 (TLR4)
   05133 Pertussis
    102959529 (TLR4)
   05134 Legionellosis
    102959529 (TLR4)
   05152 Tuberculosis
    102959529 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102959529 (TLR4)
   05161 Hepatitis B
    102959529 (TLR4)
   05171 Coronavirus disease - COVID-19
    102959529 (TLR4)
   05164 Influenza A
    102959529 (TLR4)
   05162 Measles
    102959529 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102959529 (TLR4)
   05144 Malaria
    102959529 (TLR4)
   05145 Toxoplasmosis
    102959529 (TLR4)
   05140 Leishmaniasis
    102959529 (TLR4)
   05142 Chagas disease
    102959529 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102959529 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ptg04054]
    102959529 (TLR4)
   04090 CD molecules [BR:ptg04090]
    102959529 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102959529 (TLR4)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    102959529 (TLR4)
Pattern recognition receptors [BR:ptg04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   102959529 (TLR4)
CD molecules [BR:ptg04090]
 Proteins
  102959529 (TLR4)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Hyaluronan
  Cell surface receptors
   102959529 (TLR4)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR LRR_1 TIR_2 LRR_5 LRR_9 LRR_6 DUF1863
Other DBs
NCBI-GeneID: 102959529
NCBI-ProteinID: XP_007094399
LinkDB
Position
Un
AA seq 833 aa
MMPPTRLAGTLIPAMAFLSCLRPESWDPCVEVVPNITYQCMDLNLHKIPDNIPSSTKDLD
MSFNPLSHLGSHSFSNFPELQVLDLSRCEIQIIEDDAYQGLNHLSILILTGNPIQRLFPG
AFSGLSSLQTLVAVETNIASLEDFPIGHLKMLKELNVAHNLIHSFKLPEYFSNMPNLEYL
DLSNNKIQNIYHKDLQVLHQKPLLNLSLDLSLNPLDSIQPGAFKEIKLRELTLRSNFNST
DVMKASIQGLAGLQVHQLVLGEFKNERNLERFDKSILEGLCNLTIEKFRIAYFDKFSEDA
IDSFDCLANVSTISLVHLYFNGPKQLPKNLGWQRLELVNCEFEQFPTWKLDSLKELVFSA
NEVGNTFTQVKLESLEFLDLSRNDFSFKSCCSERDLGTTRLKHLDLSFNNIITISSNFLG
LEQLEYLDFQRSSLKQVSDFSVFLPLKNLRYLDISYTHTQVAFHGIFNGLISLQILKMAG
NSFQDNFLPNIFMELTNLTILDLSDCQLEQVSQVAFNSLPKLQLLNMSHNHLLSLDTLPY
EPLHSLQTLDCSFNRIVASKEQELRHFPSNLSSLNLTRNDFACVCEHQSFLQWVKDQRQL
LVEVEQMVCAKPLDMQGMPMLNFRNATCQVSKTIITVSVFTALLVSLVVVLVYKFYFHLM
LLAGCKKYSRGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKLEKSLL
RQQVELYRLLNRNTYLEWEDSVLGRHIFWRRLRKALLDGKPRSPEGMADAEGS
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgatgcctcctacccgcctggctgggactctgatcccagccatggccttcctctcctgc
ctgagacctgagagctgggacccttgtgtggaggtggttcctaacattacttaccaatgc
atggacctgaatcttcacaaaatccccgacaacatcccctcatcaaccaaggacctggac
atgagctttaaccccctgagtcatttaggcagccatagtttctccaacttcccagaactg
caggtgctggatttatccaggtgtgaaattcaaataattgaagatgatgcatatcagggc
ctaaaccacctctccatcttgatattgacaggaaatcctatccagaggttattcccagga
gctttttctggactatcgagtttacagacgctggtggctgtggagacaaatatagcatct
ctagaggacttccccattggacatctcaaaatgttgaaggagcttaatgtggctcacaat
cttatccattccttcaaattacctgaatatttttctaacatgcccaaccttgagtatttg
gatctttccaataacaagatccaaaatatttatcataaagacttacaggttctacatcaa
aagcctctactcaacctttctttagacttgtccctaaaccctttagactctatccaacca
ggtgcctttaaagaaattaagctccgtgaactgactttgagaagtaattttaatagtaca
gatgtaatgaaagcttctattcaaggtctggcaggcttacaggtccatcagttggttctg
ggagaatttaaaaatgaaaggaacttggaaagatttgacaaatctatcctggagggactg
tgcaatttgaccatagaaaaattccggatagcatactttgacaagttctcagaggatgct
attgactcatttgattgtttggcaaacgtttctaccatttctctggtgcatctgtatttc
aacgggccaaaacagctccctaaaaatctcggatggcaacggttagaattggttaactgt
gaatttgaacaatttcccacatggaagctggactctctcaaggagcttgttttctctgcc
aacgaagttgggaacacttttactcaggttaagttggaaagccttgagtttctagatctc
agtagaaatgactttagtttcaagagttgctgttctgagagagatttggggacaaccaga
ctgaagcatttagatctaagcttcaacaatattattaccataagttcaaacttcttgggc
ttagaacagttagaatatctagatttccagcgttccagtttgaaacaggtcagtgatttt
tcagtattcctacccctcaaaaacctccgttaccttgatatttcttacactcacacccaa
gttgccttccatggcatcttcaatggcttgatcagcctccaaatcttaaaaatggctggc
aattctttccaggacaacttccttccaaatattttcatggagctgactaacttgaccatt
ctagacctctctgattgtcagctggaacaggtgtcccaagtggcatttaactcactccct
aaacttcagttgctaaatatgagtcacaaccacctcttatcattggatacacttccttat
gaaccacttcactccctccagactctggactgcagttttaaccgtatagtggcctctaag
gagcaagaactacggcattttccaagtaatctatcttccttaaatcttactcggaatgat
tttgcttgtgtttgtgaacaccagagtttcctgcagtgggtcaaggaccagaggcagctc
ttggtggaagttgaacagatggtgtgtgcaaaacctttggacatgcagggcatgcccatg
ctgaattttaggaatgctacctgtcaggtgagcaagaccatcattactgtgtcggttttc
actgcactcttggtttctctggtggtggttctggtgtataagttctatttccacctgatg
cttcttgctggctgtaaaaagtatagcagaggtgaaagcacctatgacgccttcgttatc
tactcaagccaggatgaagattgggtgaggaatgaattggtaaagaacttggaggagggg
gtgcccccttttcagctctgccttcactacagagactttattcctggtgtggccatcgcc
gccaacatcatccaggaaggtttccataaaagccggaaggttatcgtcgtggtgtcccag
cactttatccagagtcgatggtgcatctttgagtatgagattgcccagacttggcagttt
ctgagcagccgtgccggcatcatcttcatcgtcctgcagaagttggagaagtccctgctg
cggcagcaggtggagctgtatcgccttctcaacaggaacacctacctggagtgggaggac
agtgtcctggggaggcacatcttctggagacgactcagaaaagccttgctggatggtaaa
ccacgcagtccagaaggaatggcagatgcagaaggcagctag

DBGET integrated database retrieval system