KEGG   Panthera tigris altaica (Amur tiger): 102959546
Entry
102959546         CDS       T02988                                 

Gene name
IL12B
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04620  Toll-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04940  Type I diabetes mellitus
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05162  Measles
ptg05164  Influenza A
ptg05168  Herpes simplex virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05321  Inflammatory bowel disease
ptg05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102959546 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102959546 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102959546 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    102959546 (IL12B)
   04625 C-type lectin receptor signaling pathway
    102959546 (IL12B)
   04658 Th1 and Th2 cell differentiation
    102959546 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102959546 (IL12B)
   05205 Proteoglycans in cancer
    102959546 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102959546 (IL12B)
   05330 Allograft rejection
    102959546 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102959546 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102959546 (IL12B)
   05134 Legionellosis
    102959546 (IL12B)
   05152 Tuberculosis
    102959546 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102959546 (IL12B)
   05164 Influenza A
    102959546 (IL12B)
   05162 Measles
    102959546 (IL12B)
   05168 Herpes simplex virus 1 infection
    102959546 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102959546 (IL12B)
   05145 Toxoplasmosis
    102959546 (IL12B)
   05140 Leishmaniasis
    102959546 (IL12B)
   05142 Chagas disease
    102959546 (IL12B)
   05143 African trypanosomiasis
    102959546 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102959546 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102959546 (IL12B)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102959546 (IL12B)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Cytokines
   102959546 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_4 fn3 Ig_2 I-set ig DBD_Tnp_Mut
Other DBs
NCBI-GeneID: 102959546
NCBI-ProteinID: XP_007077662
LinkDB
Position
Un
AA seq 329 aa
MHPQQLVITWFSLVLLAPPLMAIWELEKNVYVVELDWHPDAPGEMVVLTCNTPEEDDITW
TSDQSSEVLGSGKTLTIQVKEFADAGQYTCHKGGEVLSHLFLLIHKKEDGIWSTDILREQ
KESKNKIFLKCEAKNYSGRFTCWWLTAISTDLKFTVKSSRGSSDPQGVTCGAATLSAEKV
RVDNRDYKKYTVECQEGSACPAAEESLPIEVVVDAIHKLKYENYTSSFFIRDIIKPDPPK
NLQLKPLKNSRHVEVSWEYPDTWSTPHSYFSLTFGVQVQGKNNREKKDRLSVDKTSAKVV
CHKDAKIRVQARDRYYSSSWSNWASVSCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcatcctcagcagctggtcatcacctggttttccctggttttgctggcacctcccctc
atggccatatgggaactggagaaaaacgtttatgttgtagagttggactggcaccctgat
gcccccggagaaatggtggtcctcacctgcaatactcctgaagaagatgacatcacctgg
acctctgaccagagcagtgaagtcctaggctctggtaaaactctgaccatccaagtcaaa
gaatttgcagatgctggccagtatacctgtcataaaggaggcgaggttctgagccatttg
ttcctcctgatacacaaaaaggaagatggaatttggtccactgatatcttaagggaacag
aaagaatccaaaaataagatctttctaaaatgtgaggcaaagaattattctggacgtttc
acctgctggtggctgacggcaatcagtaccgatttgaaattcactgtcaaaagcagcaga
ggctcctctgacccccaaggggtgacttgtggagcagcgacactctcagcagagaaggtc
agagtggacaacagggattataagaagtacacagtggagtgtcaggaaggcagtgcctgc
ccggctgccgaggagagcctacccattgaagtcgtggtggacgctattcacaagctcaag
tacgaaaactacaccagcagcttcttcatcagggacatcatcaaaccggacccgcccaag
aacctgcaactgaagccattaaaaaattctcggcatgtggaagtgagctgggaataccct
gacacctggagcaccccacattcctacttctccttaacatttggcgtacaggtccagggc
aagaacaacagagaaaagaaagatagactctccgtggacaagacctcagccaaggtcgtg
tgccacaaggatgccaagatccgcgtgcaagccagagaccgctactatagctcatcctgg
agcaactgggcatccgtgtcctgcagttag

DBGET integrated database retrieval system