KEGG   Panthera tigris altaica (Amur tiger): 102959573Help
Entry
102959573         CDS       T02988                                 

Gene name
TKT
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00030  Pentose phosphate pathway
ptg01100  Metabolic pathways
ptg01200  Carbon metabolism
ptg01230  Biosynthesis of amino acids
Module
ptg_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ptg_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102959573 (TKT)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    102959573 (TKT)
Enzymes [BR:ptg01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     102959573 (TKT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr Transketolase_N Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C XFP_N
Motif
Other DBs
NCBI-GeneID: 102959573
NCBI-ProteinID: XP_007081962
LinkDB All DBs
Position
Un
AA seq 599 aa AA seqDB search
MMHASVSLLAHSHPTSCCSAAEIMAVLFFHTMRYKPLDPRNPHNDRFILSKGHAAPILYA
VWAEAGFLPEEELLTWRKITCVLDGRPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDK
ASYRVYCMMGDGELSEGSVWEAMAFASIYKLDNLIAILDINRLGQSDPTPLQHQVDVYQK
RCEAFGWHTVIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGISGIEDKEAWHGKPLPK
NMADQIVQEICSQIQSTKKILVTPPQEDAPLVDITNIRMPSPPSYKVGDKIATRKAYGQA
LAKLGRVNDRIIALDGDTKNSTFSEIFKKEHPDRFIECYIAEQNMVSVAVGCATRNRTVP
FCSAFGAFFTRAFDQIRMAAISESNINFCGSHCGVSIGEDGPSQMALEDLAMFRSIPTAT
VFYPSDGVSTEKAVELAANTKGICFIRTSRPENAIIYNSNEDFQIKQAKVVLKSKDDQVT
VIGAGVTLHEALAAADLLKKEKINIRVLDPFTIKPLDRNLILSSARATKGRILTVEDHYY
EGGIGEAVSSALVGEPGITVSRLAVGEVPRSGKPAELLKMFGIDRDAIAQAVRDLVAKA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatgcgtctgtctctctcctggcccacagccaccccacgtcatgctgcagtgcc
gcggagatcatggctgtcctctttttccacaccatgcgctacaagcccctggacccccgg
aaccctcacaacgaccgctttatactctccaagggccacgcggctcccatcctgtatgct
gtatgggctgaggccggcttcctgcctgaggaggagctgctgacctggaggaaaatcacc
tgtgtcttggacgggcgccctgttccgaaacaagctttcaccgatgtggccactggctcc
ctgggccagggccttggggccgcttgtgggatggcctacacgggcaaatacttcgacaaa
gccagctaccgcgtctactgcatgatgggagacggggagctgtcggagggctctgtgtgg
gaggccatggccttcgccagcatctacaagctggacaacctgattgccattcttgacatc
aaccgcctgggccagagcgaccccaccccgctgcagcaccaggtggacgtctaccagaag
cgttgcgaggcctttggctggcacactgtcatcgtggatggacacagcgtggaggagctg
tgcaaggcctttggccaggccaagcaccagccgacggccatcatcgctaagaccttcaag
ggccgggggatctcaggcatagaggacaaggaggcttggcacgggaagcccctccccaaa
aacatggccgatcagattgtccaggaaatctgcagccagatccagagcacgaagaagatc
cttgtgactcccccacaagaggatgcccccttagtggacatcaccaacatccgcatgccc
agcccacccagctacaaagttggcgacaagatagctacccgcaaggcctatggacaggcc
ctggcgaagctgggccgcgtcaacgaccgcatcatcgccctggatggggataccaagaat
tccaccttctcagagatcttcaaaaaggagcacccagaccgattcattgagtgctacatt
gctgagcagaacatggtgagtgtcgccgtgggctgtgccacacgcaaccggacagtgccc
ttctgcagcgctttcggggccttcttcacacgggccttcgaccagattcgcatggcggcc
atctcggagagcaacatcaatttctgtggctcccactgtggtgtgtccatcggggaagac
gggccctctcagatggctctggaagatctggccatgtttcggtcaatccccactgcaacc
gtcttttacccaagtgatggtgtgtctacggaaaaggcagtggaattagcagccaataca
aagggtatctgcttcatccggaccagtcgcccagaaaacgccatcatctataacagcaat
gaggatttccaaatcaaacaagccaaggtggtcctgaagagcaaggatgaccaggtgact
gtgattggggccggggtgaccctgcacgaggccttggctgctgccgacctactgaagaaa
gagaagatcaacattcgtgtgttggaccccttcaccatcaagcccctggacaggaatctc
attctcagcagcgcccgagctaccaagggaaggatcctcaccgtggaggaccattactac
gaaggtggcataggtgaggcagtgtcctctgccttagtgggtgagcctggcatcactgtc
tcccgcctcgccgttggcgaggtaccaagaagtgggaagccagctgagctgctgaagatg
tttggcatcgacagggatgccattgcacaagctgtgagggaccttgtcgccaaggcctag

DBGET integrated database retrieval system