KEGG   Panthera tigris altaica (Amur tiger): 102959578
Entry
102959578         CDS       T02988                                 

Gene name
UGT1A1, UGT1A3
Definition
(RefSeq) UDP-glucuronosyltransferase 1-1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00040  Pentose and glucuronate interconversions
ptg00053  Ascorbate and aldarate metabolism
ptg00140  Steroid hormone biosynthesis
ptg00830  Retinol metabolism
ptg00860  Porphyrin and chlorophyll metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
ptg04976  Bile secretion
ptg05204  Chemical carcinogenesis
Module
ptg_M00014  Glucuronate pathway (uronate pathway)
ptg_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102959578 (UGT1A1)
   00053 Ascorbate and aldarate metabolism
    102959578 (UGT1A1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102959578 (UGT1A1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102959578 (UGT1A1)
   00860 Porphyrin and chlorophyll metabolism
    102959578 (UGT1A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102959578 (UGT1A1)
   00982 Drug metabolism - cytochrome P450
    102959578 (UGT1A1)
   00983 Drug metabolism - other enzymes
    102959578 (UGT1A1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102959578 (UGT1A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102959578 (UGT1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptg01003]
    102959578 (UGT1A1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102959578 (UGT1A1)
Glycosyltransferases [BR:ptg01003]
 Others
  Hydrophobic molecule
   102959578 (UGT1A1)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 102959578
NCBI-ProteinID: XP_007083047
LinkDB
Position
Un
AA seq 533 aa
MAARSRGPRPLVLSLLLCALNPLLSQGGKLLLVPLDGSHWLSLFGVIQRLHQRGHDVVVI
APEASVYIKEGAFYTLKSYPVPFRREDVEASFTGLGLEVFEKKPFLQRVVETYKRVKKDS
ALLLSACSHLLYNKELMASLAESGFDAMLTDPFLPCGPIVALRLALPVVFFLNSLPCGLD
FQGTRCPSPPSYVPRVLSRNSDHMTFLQRVKNMLILVSEGFLCNVVYSPYASLASEVLQK
DVTVQDLMGSASVWLFRSDFVKDYSRPIMPNMVFIGGINCASKKPLSQEFEAYVNASGEH
GIVVFSLGSMVSEIPKEKAMEIADALGKIPQTVLWRYTGTPPPNLAKNTILVKWLPQNDL
LGHPKARAFITHSGSHGIYEGICNGVPMVMLPLFGDQMDNSKRMETRGAGLTLNVLEMTS
EDLANALKAVINDKSYKENIMRLSSLHKDRPIEPVDLAVFWVEFVMRHKGALHLRPAAHD
LTWYQYHSVDVIGFLLAIVLGVVFIMYKCCAFGCRKCFGKKGRVKKSHKSKTH
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcagcgaggtcccgggggccacgtccgcttgtgctgagcctgctgctgtgtgccctg
aatccccttctgtcccagggcgggaagctgttgttggtcccattggacggcagccactgg
ctgagcttgttcggggtcatccagcggctgcaccagcggggacacgacgtagtggtcata
gctcctgaggcctccgtgtacattaaagaaggagcgttttacaccttgaagagctacccc
gtcccattccggagggaggacgtggaagcatcttttactggtctcgggctcgaggttttt
gagaagaagcctttcctgcagcgtgtggtcgagacatacaagagggtcaagaaggactct
gctctgcttttgtctgcctgctcccacttactgtacaacaaggagctgatggcctccctg
gcggaaagcggcttcgatgccatgttgacagaccctttccttccttgtggccccatcgtg
gccctgcgcctggcactgcctgtcgtgttcttcttgaactcactgccatgcggcctagat
tttcaaggtacccgctgtcccagcccaccatcctatgtgcccagggttctgtcccgtaac
tcagatcacatgactttcctccagcgggtgaagaacatgctcattcttgtgtcagagggc
ttcctgtgcaatgtggtttattccccatatgcatcacttgcttcggaagtccttcagaaa
gatgtgactgtccaggaccttatgggctccgcatcggtctggcttttcagaagtgacttt
gtaaaggattactccaggcccatcatgcccaacatggtttttattggtgggatcaactgt
gccagcaaaaagccactgtcccaggaatttgaagcctatgttaatgcttctggagaacat
ggaattgtggttttctctttgggctccatggtctcagagattcccaaggagaaagctatg
gaaattgctgatgctttgggcaaaatacctcagacagtcctgtggcggtatactggcact
ccaccaccaaatcttgcgaagaacacaatacttgtcaagtggcttccccaaaatgatctg
cttggtcacccgaaggctcgtgccttcatcacacattctggctcccatggcatatacgag
gggatatgcaacggcgttcccatggtgatgctgcccttatttggtgatcagatggacaac
tccaagcgcatggagacccggggggctggattgaccttgaacgtcctggaaatgacttct
gaagatttagcaaatgccctaaaagctgtcatcaatgacaaaagctacaaggagaacatc
atgcgcctgtccagcctgcacaaggaccgccccatcgagcccgtggacctggctgtgttc
tgggtagagttcgtgatgaggcacaagggggccctgcacctgcgccctgcagcccacgat
ctcacctggtaccagtaccactctgtggacgtgatcggcttcctcctggccattgtgctg
ggcgttgtcttcatcatgtacaaatgctgcgccttcggctgccggaagtgctttgggaaa
aaaggacgagttaagaaatctcacaagtctaagacacactga

KEGG   Panthera tigris altaica (Amur tiger): 102967993
Entry
102967993         CDS       T02988                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00040  Pentose and glucuronate interconversions
ptg00053  Ascorbate and aldarate metabolism
ptg00140  Steroid hormone biosynthesis
ptg00830  Retinol metabolism
ptg00860  Porphyrin and chlorophyll metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
ptg04976  Bile secretion
ptg05204  Chemical carcinogenesis
Module
ptg_M00014  Glucuronate pathway (uronate pathway)
ptg_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102967993
   00053 Ascorbate and aldarate metabolism
    102967993
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102967993
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102967993
   00860 Porphyrin and chlorophyll metabolism
    102967993
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102967993
   00982 Drug metabolism - cytochrome P450
    102967993
   00983 Drug metabolism - other enzymes
    102967993
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102967993
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102967993
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptg01003]
    102967993
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102967993
Glycosyltransferases [BR:ptg01003]
 Others
  Hydrophobic molecule
   102967993
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 102967993
NCBI-ProteinID: XP_007086966
LinkDB
Position
Un
AA seq 529 aa
MRTVKGFWVLFMLHLYFFDSGRTGKILVWPLDFSHWINLKVILDQLQLRGHEVTVLVPSP
SYLFDHTKIPFNVEILQLPVTKETLMEEFNGILYDISFEVPKLSWWSMQGKLTELVYRFS
RTAKRMCECAITNKELLSRLQAAKFDICLADPLSFCGELLAELLNIPFIYSFRFSYGNVI
ERLCAQLPIPSSYVPGITSGLTDRMTFVQRLENWLLYIVTDIMFLYFVFPEWDDYYSKAL
GKPATLCEIMGKAEMWLIRTYWDIEFPYPYLPNIEFVGGLHCKPAKPLPKELEEFVQSSG
KDGVVVFTLGSMIKNLTEEKSNLIASALAQIPQKVLWRYTGKKPDTLGPNTRLYEWIPQN
DLLGHPKTRAFITHCGTNGIYEAIYHGVPMVGIPMFGDQYDNIARMKAKGAALKVDLHTM
TSSDLLNALKAVINNPSYKENAMRLSRIHHDQPTKPLDRAVFWIEFVMRHKGAKHLRPTS
HDLTWIQYHSLDVIGFLLACVATTIFLVTKCCLFCCWKFGKTGKKNKRE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgaggactgtaaaaggtttctgggttcttttcatgctgcatctgtatttcttcgactct
ggaaggactgggaaaatacttgtgtggcccttggattttagtcactggattaatttaaaa
gttatcctggatcaactccagcttcgtgggcatgaggtaactgtcctggtaccttcacca
agttatctgtttgatcataccaagattccctttaatgtggagatccttcaacttccagta
actaaagaaactctcatggaagagttcaatggtattctctatgatatttcctttgaagtg
ccaaaactttcatggtggagcatgcaaggaaaactgacagaacttgtctacaggttttct
aggacagccaaaagaatgtgtgagtgtgctatcacaaataaggagttactcagcaggcta
caagcagctaagtttgatatctgtttagctgatcccttaagcttttgtggggaattgttg
gctgagctcctcaatattccatttatatactcttttcgattttcttatgggaatgtcatt
gagagactgtgtgctcagcttcctatcccttcttcatatgttcctggcatcacatcggga
ctgacagaccgcatgacttttgtacagagactagagaattggttactgtacatagtgact
gatattatgtttttatattttgtatttccggaatgggatgactattacagcaaggcttta
ggaaaacctgccacattatgtgagattatggggaaagctgaaatgtggttgattcgaact
tactgggatattgaatttccttacccttatttacctaacattgaatttgttggaggactg
cactgcaagcctgcaaagcccctaccgaaggagttagaagagtttgtccaaagctctgga
aaggatggagttgtggtatttactctgggttcaatgatcaaaaacctcacagaagaaaag
tctaatctaattgcatcagcccttgcccagattccacagaaggttctgtggagatacaca
ggaaagaaaccagacacattaggacccaatacccggctatatgaatggattccccagaat
gatcttcttggtcatcccaagaccagagcttttatcactcactgtggaaccaatgggatc
tatgaagctatttaccatggggtccctatggtgggaattcccatgtttggtgatcagtat
gataatattgctcgtatgaaagccaaaggggcagctcttaaagtagacttacatacaatg
acaagttcggatctacttaacgctttgaaggcagttattaacaacccttcctataaagag
aatgctatgaggttatcaagaattcaccatgatcagcctacaaagcccttggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagccaaacaccttcggccaacctcc
catgacctcacctggatccagtaccactcgttggatgtgattgggttcctgctggcctgt
gtggctactactatattcctggtcacaaaatgttgcctgttttgttgctggaaatttggt
aagacagggaagaagaacaagagagaatag

KEGG   Panthera tigris altaica (Amur tiger): 102968284
Entry
102968284         CDS       T02988                                 

Gene name
UGT2A1
Definition
(RefSeq) UDP-glucuronosyltransferase 2A1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00040  Pentose and glucuronate interconversions
ptg00053  Ascorbate and aldarate metabolism
ptg00140  Steroid hormone biosynthesis
ptg00830  Retinol metabolism
ptg00860  Porphyrin and chlorophyll metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
ptg04976  Bile secretion
ptg05204  Chemical carcinogenesis
Module
ptg_M00014  Glucuronate pathway (uronate pathway)
ptg_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102968284 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    102968284 (UGT2A1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102968284 (UGT2A1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102968284 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    102968284 (UGT2A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102968284 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    102968284 (UGT2A1)
   00983 Drug metabolism - other enzymes
    102968284 (UGT2A1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102968284 (UGT2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102968284 (UGT2A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptg01003]
    102968284 (UGT2A1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102968284 (UGT2A1)
Glycosyltransferases [BR:ptg01003]
 Others
  Hydrophobic molecule
   102968284 (UGT2A1)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 102968284
NCBI-ProteinID: XP_007086967
LinkDB
Position
Un
AA seq 694 aa
MLNKNILLLCLQISLLGITLGGNVLIWPMEGSHWLNIKIIIDELIEKGHNVTVLVASGAL
FITPTSTPSLTFEIYKVAFGKERIEGLIKDFVLTWMEKRPSPSTIWRFYQDIAKVIKDFH
MVSREICDGVLKNQKLMDKLKKSKFEVLISDPVFPCGDIVALKLGIPFMYSLRFSPASTV
EKHCGKVPFPPSYVPATLSELTDQMSFTDRIRNFISYSLQDYMFNTLWKSWDSYYSKALD
GSHWLNIELILEELIQRNHNVTVLASSATLFINSNPDSPVNFEVIPISYKSSNIDSLIEH
MIMLWIDHRPTPLTLWTFYKELGKFLDAAFRMNIQICDGVLNNTKLLARLQEGGFDVLLA
DPVTVCGDLVALKLGIPFVYTLRFSPASTVERHCGKIPAPASYVPAALSELTDHMTFGER
VKNTISYLLQDYIFESYWGEWNSYYSKVLGRPTTLCEVMGKAEIWLIRTYWDFEFPRPYL
PNFEFVGGLHCKPAKPLPKVLWRYKGKKPATLGANTRLYDWIPQNDLLGHPKTKAFITHG
GTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNINTMTSEDLLNALRTVINE
PSYKENATRLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHDLTWFQYHSFDVIG
FLLVCVATAIFLVTKCCLFSCQKLGKTGKKKKKE
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgttaaacaagaacattctgctgttgtgtctccagattagtctcctaggaatcactctt
ggtgggaatgttctgatttggccaatggaaggtagtcactggctgaacattaagataatt
atagatgagttgattgaaaaagggcataatgtgactgttttagttgcctctggtgcactt
ttcatcacgccaacctcgaccccatctctgacatttgaaatatataaggtggcctttggc
aaagaaagaatagaaggactgatcaaggactttgttttgacatggatggaaaagaggcca
tctccttcaaccatttggagattctatcaagatatagccaaagtcatcaaggacttccac
atggtatctagagaaatctgtgatggtgttcttaaaaaccaaaagctgatggacaagctg
aagaaaagcaaatttgaggtcctgatatcagatccagtatttccttgtggtgatatagta
gctttaaagctgggaattccatttatgtactccctcaggttttctccagcctcaacagtg
gaaaaacattgtgggaaggtaccattccctccttcctatgttcctgccactttatcagaa
ctcacggaccagatgtctttcactgacagaataagaaatttcatctcctacagtctacag
gactacatgtttaacactctttggaaatcatgggattcctactatagtaaagctttggat
ggtagccattggttaaatattgagctcattctagaagagctgatccaaagaaatcacaat
gtgactgtactggcttcatcagcaactctattcatcaactccaatcctgattctcctgtg
aattttgaagtgatacctatctcctataagagcagcaatatagactccttaattgaacac
atgataatgctgtggatagaccacagaccaactcctctcactctctggactttctacaaa
gaactaggaaaatttctagatgctgcttttcgaatgaatatacaaatctgtgatggagta
ttaaacaacaccaagttactggcaagacttcaggaaggtggttttgatgtattgttagca
gacccagtaactgtctgtggggacctggttgctctgaaattaggaattccatttgtgtac
acactgaggttctctccagcctcaacagtggagagacactgtgggaaaatccccgcacct
gcctcctatgttcctgcagctttgtcagagctcactgaccacatgacctttggtgagagg
gtaaaaaatactatatcctatcttctgcaagactacatatttgaatcctattggggagaa
tggaattcatactacagcaaagttctaggaagacccactacattatgtgaggttatgggg
aaagcagaaatttggctaatccggacatattgggattttgaatttcctcgtccatactta
cctaattttgagtttgtaggagggttgcactgtaaaccagccaaaccattacctaaggtt
ttatggagatacaaaggaaagaaaccagccacattaggagccaatactcggctctatgat
tggataccccagaatgatcttcttggtcatcccaaaacaaaagcttttatcactcatggt
ggaaccaatgggatctatgaagctatttatcatggggttcctatggtgggagttcccatg
tttgctgatcagcctgataatatcgctcacatgaaggccaaaggagcagctgtggaggtg
aacataaacacaatgacaagtgaagatctgctcaatgccttgagaacagtcattaatgaa
ccttcttataaagagaatgctacaaggttatcaaggattcaacatgatcaacctgtaaag
cccctagatcgagcagtcttctggatagagtttgtcatgcgtcacaaaggagccaagcac
ctgcgtccagctgcccatgacctcacctggttccagtaccattctttcgatgtgattggt
ttcctgctggtctgtgtagcaactgctatcttcttggtcacaaaatgttgtttgttttct
tgccaaaaacttggtaaaacaggaaagaagaaaaagaaggaatag

DBGET integrated database retrieval system