KEGG   Panthera tigris altaica (Amur tiger): 102959906
Entry
102959906         CDS       T02988                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg04068  FoxO signaling pathway
ptg04110  Cell cycle
ptg04115  p53 signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04218  Cellular senescence
ptg04310  Wnt signaling pathway
ptg04340  Hedgehog signaling pathway
ptg04371  Apelin signaling pathway
ptg04390  Hippo signaling pathway
ptg04510  Focal adhesion
ptg04530  Tight junction
ptg04630  JAK-STAT signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04934  Cushing syndrome
ptg05160  Hepatitis C
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05169  Epstein-Barr virus infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05216  Thyroid cancer
ptg05218  Melanoma
ptg05219  Bladder cancer
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102959906 (CCND1)
   04340 Hedgehog signaling pathway
    102959906 (CCND1)
   04390 Hippo signaling pathway
    102959906 (CCND1)
   04371 Apelin signaling pathway
    102959906 (CCND1)
   04630 JAK-STAT signaling pathway
    102959906 (CCND1)
   04068 FoxO signaling pathway
    102959906 (CCND1)
   04151 PI3K-Akt signaling pathway
    102959906 (CCND1)
   04152 AMPK signaling pathway
    102959906 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102959906 (CCND1)
   04115 p53 signaling pathway
    102959906 (CCND1)
   04218 Cellular senescence
    102959906 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102959906 (CCND1)
   04530 Tight junction
    102959906 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102959906 (CCND1)
   04921 Oxytocin signaling pathway
    102959906 (CCND1)
   04919 Thyroid hormone signaling pathway
    102959906 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102959906 (CCND1)
   05206 MicroRNAs in cancer
    102959906 (CCND1)
   05205 Proteoglycans in cancer
    102959906 (CCND1)
   05203 Viral carcinogenesis
    102959906 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102959906 (CCND1)
   05212 Pancreatic cancer
    102959906 (CCND1)
   05225 Hepatocellular carcinoma
    102959906 (CCND1)
   05226 Gastric cancer
    102959906 (CCND1)
   05214 Glioma
    102959906 (CCND1)
   05216 Thyroid cancer
    102959906 (CCND1)
   05221 Acute myeloid leukemia
    102959906 (CCND1)
   05220 Chronic myeloid leukemia
    102959906 (CCND1)
   05218 Melanoma
    102959906 (CCND1)
   05219 Bladder cancer
    102959906 (CCND1)
   05215 Prostate cancer
    102959906 (CCND1)
   05213 Endometrial cancer
    102959906 (CCND1)
   05224 Breast cancer
    102959906 (CCND1)
   05222 Small cell lung cancer
    102959906 (CCND1)
   05223 Non-small cell lung cancer
    102959906 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102959906 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102959906 (CCND1)
   04934 Cushing syndrome
    102959906 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102959906 (CCND1)
   05162 Measles
    102959906 (CCND1)
   05160 Hepatitis C
    102959906 (CCND1)
   05163 Human cytomegalovirus infection
    102959906 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102959906 (CCND1)
   05169 Epstein-Barr virus infection
    102959906 (CCND1)
   05165 Human papillomavirus infection
    102959906 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102959906 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 102959906
NCBI-ProteinID: XP_015398426
LinkDB
Position
Un
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVLAAVQGLPLGSSNSFLSYPRLTRFLSKVIKCD
ADCLRACQEQIEALLEASLRQAQQQSLDPKAAEEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccaactcttatgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgtgaggagcagaagtgcgaggaagaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccattccgctgacg
gccgagaagctgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgcgatgaccccgcacgatttc
atcgagcacttcctctccaaaatgcccgtggccgaggagaacaaacagatcatccggaag
cacgcgcagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaacccgcct
tccatggtggcagcggggagcgtgctggccgcggtgcaaggcctgcccctgggaagctcc
aacagcttcctgtcctatccgcgcctcacccggttcctctccaaagtgatcaagtgcgac
gcggactgcctccgggcgtgccaggagcagatcgaggccctgctggaggccagcctgcgc
caggcccagcagcagagcctagaccccaaggcggcggaggaggaggaggaggaggaggag
gccgacctggcctgcacacccaccgacgttcgagacgtgaacatttga

DBGET integrated database retrieval system