KEGG   Panthera tigris altaica (Amur tiger): 102960157
Entry
102960157         CDS       T02988                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04120  Ubiquitin mediated proteolysis
ptg04140  Autophagy - animal
ptg04144  Endocytosis
ptg04380  Osteoclast differentiation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05222  Small cell lung cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102960157 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102960157 (TRAF6)
   04064 NF-kappa B signaling pathway
    102960157 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102960157 (TRAF6)
   04140 Autophagy - animal
    102960157 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102960157 (TRAF6)
   04621 NOD-like receptor signaling pathway
    102960157 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    102960157 (TRAF6)
   04657 IL-17 signaling pathway
    102960157 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102960157 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102960157 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102960157 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102960157 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102960157 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102960157 (TRAF6)
   05135 Yersinia infection
    102960157 (TRAF6)
   05133 Pertussis
    102960157 (TRAF6)
   05152 Tuberculosis
    102960157 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102960157 (TRAF6)
   05161 Hepatitis B
    102960157 (TRAF6)
   05160 Hepatitis C
    102960157 (TRAF6)
   05171 Coronavirus disease - COVID-19
    102960157 (TRAF6)
   05162 Measles
    102960157 (TRAF6)
   05168 Herpes simplex virus 1 infection
    102960157 (TRAF6)
   05169 Epstein-Barr virus infection
    102960157 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102960157 (TRAF6)
   05140 Leishmaniasis
    102960157 (TRAF6)
   05142 Chagas disease
    102960157 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102960157 (TRAF6)
   04121 Ubiquitin system [BR:ptg04121]
    102960157 (TRAF6)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102960157 (TRAF6)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102960157 (TRAF6)
Ubiquitin system [BR:ptg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    102960157 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4_4 zf-TRAF_2 zf-RING_5 Med21 U-box DUF4455 Spc29 Tropomyosin_1 UPF0242 Laminin_I DUF16 SlyX Sina EzrA CENP-F_leu_zip
Other DBs
NCBI-GeneID: 102960157
NCBI-ProteinID: XP_007082121
LinkDB
Position
Un
AA seq 541 aa
MSLLNCENSCGSSQSESDCCAAMASSCSAAVKDDSVSGTASTGNLSSSFMEETQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCRACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMNCPQCQRPFQKCQLNIHILQ
ECPRRQVSCVNCAALMAFEDKEIHDQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPI
PCTFSTFGCHVKMQRNHLARHLQENTQSHMRMLAQAVQSLSLALPPVPQCDMPPYDSSSA
SRVSTGCHPEVQNFQETIQQLEGRLVRQDHQIRELIAKMETQSMYVSELKQTIRTLEDKV
VEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQ
RCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPIRQNHEEIMDAKPELLAFQR
PTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSG
M
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgcggatccagccagtctgagagtgactgctgt
gccgccatggccagctcctgtagtgctgcggtgaaagatgacagtgtgagtggaaccgcc
agcacggggaacctctccagctctttcatggaagagacccaggggtatgacgtggagttt
gacccgcccctggagagcaagtatgagtgccccatctgcctgatggctctccgggaggca
gtgcagacaccgtgcggccacaggttctgcagagcttgcatcatcaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttcctgac
aattttgcaaaacgagagattctttctctgatggtgaaatgtccaaatgaaggttgtttg
cacaagatggaactgaggcatcttgaggatcaccaagcacattgtgaatttgctcttatg
aattgtcctcagtgccagcgtcccttccaaaaatgccaacttaacattcacattctccag
gagtgtccaaggagacaggtttcttgtgtaaactgtgctgcattgatggcatttgaagat
aaagagatccacgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatacc
atgctcatcagagaacagatgcctaatcattacgacctggactgtcctacagccccaatt
ccatgcacattcagtactttcggttgccatgtaaagatgcagaggaatcacttggcacgc
cacctgcaagagaatacccagtcgcacatgagaatgttggcccaggctgttcagagttta
agccttgcgttacctcctgtacctcagtgtgatatgcctccatacgattcttcctctgcg
tcccgggtttccactgggtgtcacccagaggttcagaatttccaagaaaccattcagcag
ttagagggtcgccttgtaagacaagaccatcaaatccgagagctaattgctaaaatggaa
actcagagcatgtacgtaagtgagctcaaacaaacgattcgaacccttgaggacaaagtt
gttgaaatagaagcacagcagtgcaatgggatttacatctggaagattggcaactttggg
atgcatttgaaatctcaagaagaggagaaacctgttgtcattcatagccctggattctac
acaggcaaacccgggtacaaactgtgcatgcgcctgcaccttcagttaccgtcggctcag
cgctgtgctaattacatatccctctttgtgcacacaatgcaaggagagtatgacagccac
ctcccttggcccttccaaggtacaatccgccttacaattcttgatcagtctgaggcacct
ataaggcaaaaccatgaagagatcatggatgccaaaccagagctgcttgccttccagaga
cccacaatcccacggaacccaaaaggttttggctatgtgacttttatgcatctggaagcc
ctgagacagagaaccttcattaaggacgatactttattagtgcgctgtgaggtctctacc
cgctttgacatgggtagtctccggagggagggttttcagccacgaagtactgattcaggg
atgtag

DBGET integrated database retrieval system