KEGG   Panthera tigris altaica (Amur tiger): 102960189
Entry
102960189         CDS       T02988                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg04151  PI3K-Akt signaling pathway
ptg04217  Necroptosis
ptg04380  Osteoclast differentiation
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04621  NOD-like receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg05140  Leishmaniasis
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05212  Pancreatic cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102960189 (JAK1)
   04151 PI3K-Akt signaling pathway
    102960189 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102960189 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102960189 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102960189 (JAK1)
   04658 Th1 and Th2 cell differentiation
    102960189 (JAK1)
   04659 Th17 cell differentiation
    102960189 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102960189 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102960189 (JAK1)
   05203 Viral carcinogenesis
    102960189 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102960189 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102960189 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102960189 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102960189 (JAK1)
   05161 Hepatitis B
    102960189 (JAK1)
   05160 Hepatitis C
    102960189 (JAK1)
   05171 Coronavirus disease - COVID-19
    102960189 (JAK1)
   05164 Influenza A
    102960189 (JAK1)
   05162 Measles
    102960189 (JAK1)
   05168 Herpes simplex virus 1 infection
    102960189 (JAK1)
   05163 Human cytomegalovirus infection
    102960189 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102960189 (JAK1)
   05169 Epstein-Barr virus infection
    102960189 (JAK1)
   05165 Human papillomavirus infection
    102960189 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102960189 (JAK1)
   05140 Leishmaniasis
    102960189 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102960189 (JAK1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102960189 (JAK1)
Protein kinases [BR:ptg01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102960189 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 RIO1 SH2
Other DBs
NCBI-GeneID: 102960189
NCBI-ProteinID: XP_007089908
LinkDB
Position
Un
AA seq 1158 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEL
LXXXXXXQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKTSLRLHYRMRFYFTNWHG
TNDNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKT
EQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRM
RINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENE
MNWFHPDDSGNILYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKWKKLENKHKKDEEKNKI
REEWNNFSYFPEITHIVIKECVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADA
HHYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTV
TCFEKSEVVGSQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMNHLKKQILRTDNISFVL
KRCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIVQGEHLGRGTRTHIYSG
TLLDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSEFGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPTNRT
TFQNLIKGFEALLEALLK
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagacggaggtgaatctggaggcccccgaaccaggagtggaagtgctcttc
tatctgtccgatagggagccgctccggctgggcagcggggagtacacagcagaggagctg
cttnnnnnnnnnnnnnnnnnncaggaatgctgtatctctcctctgtgtcacaaccttttt
gccctgtatgatgagaacaccaagctttggtacgctccgaatcgcacgatcacagttgac
gacaagacatcactccggctccactaccggatgaggttctatttcaccaactggcatggg
accaatgataatgagcagtctgtatggcgacattctccgaagaagcagaaaaatggctac
gagaaaaaaaaagttccagatgcaacccctctccttgacgccagctccctggagtatctg
tttgctcagggacaatatgatttggtcaaatgcctggctcccattcgagaccccaagacc
gagcaggatggacacgatattgagaacgagtgtctgggaatggctgtcctggccatctcc
cactacgccatgatgaagaagatgcaattgccagaactgcccaaggacatcagctacaag
cgatatatcccagaaacattgaataagtccatcaggcagaggaatcttctcaccaggatg
cggataaataacgttttcaaggatttcctaaaggaatttaacaacaagaccatctgtgac
agcagtgtatctactcatgacctgaaggtgaaatacctggcgaccttggagactttgaca
aaacattatggtgctgaaatatttgagacttccatgttactgatttcgtcagaaaatgag
atgaattggtttcatccagatgacagtggaaacattctctatgaagtgatggtaactgga
aatcttggaatccagtggagacagaaaccaaatgttgttcctgttgaaaaggaaaaaaac
aaactgaaatggaaaaagctggaaaataaacacaagaaggatgaggagaaaaacaaaatc
cgggaagagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggag
tgtgtggtcagcatcaataagcaggacaataaaaaaatggaactgaagctttcgtcccac
gaggaggccttgtcctttgtgtccctggtagacggctacttccggctcacagcggatgcc
catcattacctctgcactgatgtggctcccccactgattgtccacaacatacagaatggt
tgtcacggtcccatctgcacagaatatgccatcaataaattgcggcaagaaggaagcgag
gagggaatgtatgtgctgaggtggagctgtaccgactttgacaatatcctcatgactgtc
acctgctttgaaaaatctgaggtggtgggtagccaaaaacagttcaagaactttcagatc
gaggtgcagaagggccgttacagcctgcatggctcggaccgcagcttccccagcctgggg
gacctcatgaaccacctcaagaaacagatcctgcggacggacaacatcagcttcgtgctg
aagcgctgctgccagcccaagccccgagagatctccaatttgctggtggctactaagaaa
gcccaggagtggcagcctgtctactctatgagccagctgagttttgaccggatcctcaag
aaagatatcgtgcaaggcgagcaccttgggagaggcacgcggacgcacatctactctgga
acccttctggattacaaagatgacgaaggaacttccgaagaaaagagaataaaagtgatc
ctcaaagtcttagaccccagccacagggacatttctctggccttctttgaggcagccagc
atgatgaggcaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgagat
gtggaaaatatcatggtggaggagtttgtggagggggggcccctggatctcttcatgcac
cggaaaagcgatgtcctcaccacaccgtggaagtttaaagttgccaaacaactggccagt
gccttgagttacttggaggataaagacctggtccacggaaatgtgtgcactaaaaacctc
ctcttggcccgtgagggcatcgacagcgagttcggcccgttcatcaagctcagtgacccc
ggcatccccatcaccgtgctgtccaggcaagagtgcatagaacgaatcccgtggattgct
cccgagtgtgttgaagactccaagaacctgagtgtggccgctgacaaatggagctttgga
accacactctgggaaatctgctacaatggcgagatccctctgaaagacaagacactgatt
gagaaagagcgattctatgaaagccggtgccggccagtgacaccatcttgtaaggagctg
gctgacctcatgacccgctgtatgaactatgaccccaaccagagacccttcttccgagcc
atcatgagagacatcaataaactggaggagcagaatccagacattgtttcagaacgaaag
ccggcaaccgaagtggatcccacacattttgaaaagcggttcttgaagagaatccgtgac
ttgggagagggccactttgggaaggttgagctctgcagatacgaccctgagggtgacaat
accggggagcaggtggctgtcaaatccctgaagcctgagagtggaggtaaccacatagct
gatctgaagaaggaaattgaaatcttaaggaacctctatcatgagaacattgtgaagtac
aaaggcatctgtacagaagacggaggaaatggtattaagctcatcatggagtttctacct
tcaggaagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacaacag
ttaaaatatgctgttcagatttgtaaggggatggactacttggggtctcggcagtacgtt
caccgggacttagcagcaagaaatgtcctcgttgagagtgagcaccaagtgaaaattgga
gacttcggtttaaccaaagccattgaaaccgacaaagagtactacacagtcaaggatgat
cgggacagccctgtgttttggtatgctccagaatgtttaattcagtgtaaattttatatc
gcctctgacgtctggtcgtttggagtgactctgcatgagctgctcacttactgtgactcc
gattccagccccatggcattgttcctgaaaatgataggcccaacgcatggccagatgaca
gtcacaagacttgtgaacacgttaaaagaaggaaaacgtttgccctgtccacctaactgc
ccagatgaggtttatcaactcatgagaaagtgctgggaattccaaccaactaataggaca
acttttcagaacctaattaaaggatttgaagcacttttagaagcacttttaaaataa

KEGG   Panthera tigris altaica (Amur tiger): 102966280
Entry
102966280         CDS       T02988                                 

Gene name
JAK3
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04062  Chemokine signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04217  Necroptosis
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04630  JAK-STAT signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg05161  Hepatitis B
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05223  Non-small cell lung cancer
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102966280 (JAK3)
   04151 PI3K-Akt signaling pathway
    102966280 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102966280 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102966280 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102966280 (JAK3)
   04659 Th17 cell differentiation
    102966280 (JAK3)
   04062 Chemokine signaling pathway
    102966280 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102966280 (JAK3)
   05203 Viral carcinogenesis
    102966280 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102966280 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    102966280 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102966280 (JAK3)
   05161 Hepatitis B
    102966280 (JAK3)
   05162 Measles
    102966280 (JAK3)
   05169 Epstein-Barr virus infection
    102966280 (JAK3)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102966280 (JAK3)
Protein kinases [BR:ptg01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102966280 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F1
Other DBs
NCBI-GeneID: 102966280
NCBI-ProteinID: XP_007088709
LinkDB
Position
Un
AA seq 815 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDHSAEELCVWAAKA
SGILPVYHSLFALATEDLSYWYPPSHIFSVEDASTQVLLYRLRFYFPNWFGLEKCHRFGL
RKDLASAVLDLPGLEHLFAQGGVRMGLDFAINKLKTGGSLPGSYVLRRSPQDFDSFLLTV
CVQTPLGPDYKGCLIRCDPSGTFSLAGLGRPHSSLRELLAACWDAGLHVDGVALNLTSCC
APRPKEKSNLIVVRRGCSAPTSSLVWPQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKI
YRGCRHEAVDGEARETEVLLKVMDAKHRNCMESFLEAASLMSQVSYQHLVLLHGVCMAGD
SVMVQEFVRLGALDTYLRKSGPLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLL
AREGADGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATV
WEVFSGIPMPISTLDPAKKLQFYEERQHLPAPKWMELATLIQQCMAYEPGQRPSFRAIIR
DLNSLITSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGS
VELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPDH
GLPISRPSLPHNLVPPRSAPLSWPLSLEPRLSALSPPRPPFGYAPESLSDNIFSRQSDVW
SFGVVLYELFTYGSKNCSPSAEFLRMMGCERDVPALCRLLELLAEGQRLPAPPACPGEVH
ELMKLCWAPSPQDRPTFSALGPQLDTLWSGSRGVA
NT seq 2448 nt   +upstreamnt  +downstreamnt
atggcgcctccaagtgaggagacacccctgatccctcagcgttcctgcagcctctcatct
tcagaggctggtgccctgcacgtgctgctgccccctcggggacccggacccccacaacgc
ctgtccttctcctttggggaccattcagctgaagagctatgtgtttgggctgctaaggcc
agtggcatcctgcctgtgtaccactccctctttgctctggccacggaggacctgtcctac
tggtaccccccgagccacatcttctccgtggaggatgcaagcacccaagtcctgctctac
aggctccgcttttacttccccaactggtttgggttggagaaatgccaccgcttcgggctg
cggaaggacttggccagtgccgtccttgacctgccaggcctggagcatctcttcgcccag
ggaggggtccgcatgggcctggattttgccatcaacaagctcaagaccgggggctccctt
cccggctcctatgttctccgccgcagcccccaggatttcgacagcttcctcctcactgtc
tgcgtccagacccccctgggtcctgattacaagggctgcctcatccggtgtgacccctcg
ggaaccttctccctggctggcctcggccggccccacagcagtcttcgagagctcttggca
gcctgctgggatgctgggctgcacgtggatggggttgcgctgaacctcacctcctgctgc
gcccccagacccaaagaaaagtccaacctgatcgtggtgcggagaggttgcagcgctccc
acgtcatcccttgtttggccccaatcccagtgccagctgagtcagatgacgtttcacaag
atccctgctgacagcctggagtggcatgagaacctgggtcatgggtccttcaccaagatt
taccgaggttgtcgccatgaggctgtggacggggaagcccgggagacagaggtgctactc
aaagtgatggatgccaagcacagaaactgcatggagtccttcctggaagcagcgagcctg
atgagccaagtgtcgtatcagcacctcgtgttgctccacggcgtgtgcatggctggagac
agtgtcatggtgcaggaattcgtgcgcctgggagccctggatacatatctgcgcaagtct
ggccccctggtaccagccagctggaagctgcaggtgatcaaacagctggcctatgccctc
aactatctggaagacaaaggcctcccccatggcaatgtctcagcccggaaggtgctcttg
gctcgggagggggctgacgggaacctgcccttcatcaagttgagtgaccctggtgtcagc
cccactgtgctgagcctggagatgctcactgacaggatcccctgggtggcccctgagtgt
ctccaggaggcccggacccttggcttggaagctgacaagtggggtttcggtgccacagtc
tgggaagtgttcagcgggatcccgatgcccatcagtaccctggatcctgccaagaagctc
cagttttacgaggaacggcagcaccttcctgcccccaagtggatggagctggctacactg
atccaacagtgcatggcctatgagccaggccagaggccctccttccgcgccatcatccgt
gacctgaacagcctcatcacttcagattatgagctcctctcagaccccacacctggtgcc
ttggcgccccgtgatgggctgtggaatggcgcccagctctacgcctgccaggaccctacc
atttttgaggagaggcatctcaagtacatctcacagctgggcaagggcaactttggcagt
gtggagctgtgccgctatgacccgctgggcgacaacacgggcgccctagtggctgtgaag
cagcttcagcacagcgggccagaccagcagagggacttccagcgggagatccagatcctc
aaagccctccacagcgacttcattgtcaagtaccgcggtgtcagctatggcccggaccac
ggccttcctatcagcagaccctcccttccgcacaacctggtcccacctcgctccgcccct
ctgtcctggcccctctccctggagccacggctctccgccctgagcccgcccagacccccc
tttgggtatgccccagagtccctctctgacaacatcttctcgcgccagtcggacgtctgg
agcttcggggtcgtcctgtacgagcttttcacctacggcagcaagaactgcagcccctca
gccgagttcctccgtatgatgggatgtgagcgagacgtccccgccctctgccgcctcctg
gagctgctggctgagggccagaggctgcccgcgcctcccgcctgccccggtgaggttcat
gagctcatgaagctgtgctgggccccgagcccgcaagaccggccaacattcagtgccctg
ggcccccagctggatacactgtggagtggaagccggggggtagcatag

DBGET integrated database retrieval system