KEGG   Panthera tigris altaica (Amur tiger): 102960296
Entry
102960296         CDS       T02988                                 

Gene name
IL7
Definition
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04151  PI3K-Akt signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04640  Hematopoietic cell lineage
ptg05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102960296 (IL7)
   04151 PI3K-Akt signaling pathway
    102960296 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102960296 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102960296 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102960296 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102960296 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102960296 (IL7)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102960296 (IL7)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Cytokines
   102960296 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 102960296
NCBI-ProteinID: XP_007073863
LinkDB
Position
Un
AA seq 158 aa
MFHVSFRYIFGIPPLILVLLPVASSDCDIEGKDGREYQHILMISINYLDTMIKNRTNCPN
NEPNVFKKHACDDNKEAVFLYRAAHKLKHFVKVNNSEEFNLHLSRVSQGMLQLLNCTPKE
DSKSLKEQRKQKSLCFLGILLQKIKTCWNKILRGSKEH
NT seq 477 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagacggaagagaatatcagcacatt
ctaatgatcagcatcaattacttggacaccatgataaaaaatcgtaccaattgcccgaat
aatgaacctaacgtttttaaaaaacatgcatgtgatgataataaggaagctgtgttttta
tatcgtgctgctcacaagttgaagcactttgtcaaagtgaataacagtgaggaattcaat
ctccacttatcaagagtttcacagggcatgttacagttgttgaactgtacccccaaggaa
gacagcaaatctttaaaggaacagagaaaacagaagagcttgtgtttcctagggatacta
ctacaaaagataaaaacttgttggaataaaattttgaggggctctaaagaacattga

DBGET integrated database retrieval system