Panthera tigris altaica (Amur tiger): 102960306 Help Entry 102960306         CDS       T02988                                  Gene name MAPK12 Definition (RefSeq) mitogen-activated protein kinase 12   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01522   Endocrine resistance ptg04010   MAPK signaling pathway ptg04015   Rap1 signaling pathway ptg04068   FoxO signaling pathway ptg04071   Sphingolipid signaling pathway ptg04114   Oocyte meiosis ptg04218   Cellular senescence ptg04261   Adrenergic signaling in cardiomyocytes ptg04370   VEGF signaling pathway ptg04380   Osteoclast differentiation ptg04550   Signaling pathways regulating pluripotency of stem cells ptg04611   Platelet activation ptg04613   Neutrophil extracellular trap formation ptg04620   Toll-like receptor signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04622   RIG-I-like receptor signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04657   IL-17 signaling pathway ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04660   T cell receptor signaling pathway ptg04664   Fc epsilon RI signaling pathway ptg04668   TNF signaling pathway ptg04670   Leukocyte transendothelial migration ptg04714   Thermogenesis ptg04722   Neurotrophin signaling pathway ptg04723   Retrograde endocannabinoid signaling ptg04728   Dopaminergic synapse ptg04750   Inflammatory mediator regulation of TRP channels ptg04912   GnRH signaling pathway ptg04914   Progesterone-mediated oocyte maturation ptg04917   Prolactin signaling pathway ptg04926   Relaxin signaling pathway ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg04935   Growth hormone synthesis, secretion and action ptg05014   Amyotrophic lateral sclerosis ptg05020   Prion disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05132   Salmonella infection ptg05133   Pertussis ptg05135   Yersinia infection ptg05140   Leishmaniasis ptg05142   Chagas disease ptg05145   Toxoplasmosis ptg05152   Tuberculosis ptg05161   Hepatitis B ptg05163   Human cytomegalovirus infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05169   Epstein-Barr virus infection ptg05170   Human immunodeficiency virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05205   Proteoglycans in cancer ptg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102960306 (MAPK12)    04015 Rap1 signaling pathway     102960306 (MAPK12)    04370 VEGF signaling pathway     102960306 (MAPK12)    04668 TNF signaling pathway     102960306 (MAPK12)    04068 FoxO signaling pathway     102960306 (MAPK12)    04071 Sphingolipid signaling pathway     102960306 (MAPK12)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102960306 (MAPK12)    04218 Cellular senescence     102960306 (MAPK12)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102960306 (MAPK12)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102960306 (MAPK12)    04613 Neutrophil extracellular trap formation     102960306 (MAPK12)    04620 Toll-like receptor signaling pathway     102960306 (MAPK12)    04621 NOD-like receptor signaling pathway     102960306 (MAPK12)    04622 RIG-I-like receptor signaling pathway     102960306 (MAPK12)    04625 C-type lectin receptor signaling pathway     102960306 (MAPK12)    04660 T cell receptor signaling pathway     102960306 (MAPK12)    04658 Th1 and Th2 cell differentiation     102960306 (MAPK12)    04659 Th17 cell differentiation     102960306 (MAPK12)    04657 IL-17 signaling pathway     102960306 (MAPK12)    04664 Fc epsilon RI signaling pathway     102960306 (MAPK12)    04670 Leukocyte transendothelial migration     102960306 (MAPK12)   09152 Endocrine system    04912 GnRH signaling pathway     102960306 (MAPK12)    04914 Progesterone-mediated oocyte maturation     102960306 (MAPK12)    04917 Prolactin signaling pathway     102960306 (MAPK12)    04926 Relaxin signaling pathway     102960306 (MAPK12)    04935 Growth hormone synthesis, secretion and action     102960306 (MAPK12)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102960306 (MAPK12)   09156 Nervous system    04728 Dopaminergic synapse     102960306 (MAPK12)    04723 Retrograde endocannabinoid signaling     102960306 (MAPK12)    04722 Neurotrophin signaling pathway     102960306 (MAPK12)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102960306 (MAPK12)   09158 Development and regeneration    04380 Osteoclast differentiation     102960306 (MAPK12)   09159 Environmental adaptation    04714 Thermogenesis     102960306 (MAPK12)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102960306 (MAPK12)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102960306 (MAPK12)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102960306 (MAPK12)    05020 Prion disease     102960306 (MAPK12)    05022 Pathways of neurodegeneration - multiple diseases     102960306 (MAPK12)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102960306 (MAPK12)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102960306 (MAPK12)   09171 Infectious disease: bacterial    05132 Salmonella infection     102960306 (MAPK12)    05135 Yersinia infection     102960306 (MAPK12)    05133 Pertussis     102960306 (MAPK12)    05152 Tuberculosis     102960306 (MAPK12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102960306 (MAPK12)    05161 Hepatitis B     102960306 (MAPK12)    05171 Coronavirus disease - COVID-19     102960306 (MAPK12)    05163 Human cytomegalovirus infection     102960306 (MAPK12)    05167 Kaposi sarcoma-associated herpesvirus infection     102960306 (MAPK12)    05169 Epstein-Barr virus infection     102960306 (MAPK12)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102960306 (MAPK12)    05140 Leishmaniasis     102960306 (MAPK12)    05142 Chagas disease     102960306 (MAPK12)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102960306 (MAPK12)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ptg01001]     102960306 (MAPK12) Enzymes [BR:ptg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102960306 (MAPK12) Protein kinases [BR:ptg01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102960306 (MAPK12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like DUF4375 UvrD_C Motif Other DBs NCBI-GeneID:  102960306 NCBI-ProteinID:  XP_015398327 LinkDB All DBs Position Un AA seq 301 aa AA seqDB search AVDSRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFT DFYLVMPFMGTDLGKLMKHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNE DCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMHYTQTVDIWSAGCIMAEMITGK TLFKGSDHLDQLKEIMKVTGTPPDEFVQRLQSAEAKNYMKGLPELEKKDFASILTNAKAL THPYFESLQDTEDEPKAQKYDESFDDVDRTLDEWKRVTYKEVLSFKPPRQLGTKVSKETA L NT seq 906 nt NT seq  +upstreamnt  +downstreamnt gccgtggacagccgcaccggtgccaaggtggccatcaagaagctgtaccggcccttccag tccgagctgttcgccaagcgcgcctaccgcgagcttcgcctcctcaagcacatgcgtcac gagaacgtcatcgggctgctggacgtgttcactcctgacgaaaccctggatgatttcaca gacttttacctggtgatgccgttcatgggcactgacctgggcaaactcatgaagcacgag aagctgagcgaggaccgaatccagttccttgtctaccagatgctgaaggggctaaagtac atccatgctgctggcatcatccacagggacctgaagcctggcaatctggcagtgaatgag gactgtgagctgaagatcctggacttcggcttggccaggcaggccgacagcgagatgact gggtacgtggtgacccggtggtaccgtgcacctgaggtcatcttgaattggatgcactac acccagacggtggacatctggtcagcgggctgcatcatggcagagatgatcacagggaag acgctgttcaagggcagtgaccacctggaccagctgaaggagatcatgaaggtgacaggg actcctcccgatgaatttgtgcagaggctgcagagtgccgaagcgaagaactacatgaag ggcctccccgagttggagaagaaggattttgcctccatcctgactaacgcaaaggcgctc acacacccctacttcgagtcactgcaggacacggaggatgaacccaaggcccagaagtac gacgagtcctttgacgatgtggatcgcacgctggacgagtggaagcgtgtcacatataag gaagtgctcagcttcaagcctccccggcagctggggaccaaggtgtccaaggagacagcg ctgtga

Panthera tigris altaica (Amur tiger): 102960590 Help Entry 102960590         CDS       T02988                                  Gene name MAPK11 Definition (RefSeq) mitogen-activated protein kinase 11   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01522   Endocrine resistance ptg04010   MAPK signaling pathway ptg04015   Rap1 signaling pathway ptg04068   FoxO signaling pathway ptg04071   Sphingolipid signaling pathway ptg04114   Oocyte meiosis ptg04218   Cellular senescence ptg04261   Adrenergic signaling in cardiomyocytes ptg04370   VEGF signaling pathway ptg04380   Osteoclast differentiation ptg04550   Signaling pathways regulating pluripotency of stem cells ptg04611   Platelet activation ptg04613   Neutrophil extracellular trap formation ptg04620   Toll-like receptor signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04622   RIG-I-like receptor signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04657   IL-17 signaling pathway ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04660   T cell receptor signaling pathway ptg04664   Fc epsilon RI signaling pathway ptg04668   TNF signaling pathway ptg04670   Leukocyte transendothelial migration ptg04714   Thermogenesis ptg04722   Neurotrophin signaling pathway ptg04723   Retrograde endocannabinoid signaling ptg04728   Dopaminergic synapse ptg04750   Inflammatory mediator regulation of TRP channels ptg04912   GnRH signaling pathway ptg04914   Progesterone-mediated oocyte maturation ptg04917   Prolactin signaling pathway ptg04926   Relaxin signaling pathway ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg04935   Growth hormone synthesis, secretion and action ptg05014   Amyotrophic lateral sclerosis ptg05020   Prion disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05132   Salmonella infection ptg05133   Pertussis ptg05135   Yersinia infection ptg05140   Leishmaniasis ptg05142   Chagas disease ptg05145   Toxoplasmosis ptg05152   Tuberculosis ptg05161   Hepatitis B ptg05163   Human cytomegalovirus infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05169   Epstein-Barr virus infection ptg05170   Human immunodeficiency virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05205   Proteoglycans in cancer ptg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102960590 (MAPK11)    04015 Rap1 signaling pathway     102960590 (MAPK11)    04370 VEGF signaling pathway     102960590 (MAPK11)    04668 TNF signaling pathway     102960590 (MAPK11)    04068 FoxO signaling pathway     102960590 (MAPK11)    04071 Sphingolipid signaling pathway     102960590 (MAPK11)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102960590 (MAPK11)    04218 Cellular senescence     102960590 (MAPK11)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102960590 (MAPK11)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102960590 (MAPK11)    04613 Neutrophil extracellular trap formation     102960590 (MAPK11)    04620 Toll-like receptor signaling pathway     102960590 (MAPK11)    04621 NOD-like receptor signaling pathway     102960590 (MAPK11)    04622 RIG-I-like receptor signaling pathway     102960590 (MAPK11)    04625 C-type lectin receptor signaling pathway     102960590 (MAPK11)    04660 T cell receptor signaling pathway     102960590 (MAPK11)    04658 Th1 and Th2 cell differentiation     102960590 (MAPK11)    04659 Th17 cell differentiation     102960590 (MAPK11)    04657 IL-17 signaling pathway     102960590 (MAPK11)    04664 Fc epsilon RI signaling pathway     102960590 (MAPK11)    04670 Leukocyte transendothelial migration     102960590 (MAPK11)   09152 Endocrine system    04912 GnRH signaling pathway     102960590 (MAPK11)    04914 Progesterone-mediated oocyte maturation     102960590 (MAPK11)    04917 Prolactin signaling pathway     102960590 (MAPK11)    04926 Relaxin signaling pathway     102960590 (MAPK11)    04935 Growth hormone synthesis, secretion and action     102960590 (MAPK11)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102960590 (MAPK11)   09156 Nervous system    04728 Dopaminergic synapse     102960590 (MAPK11)    04723 Retrograde endocannabinoid signaling     102960590 (MAPK11)    04722 Neurotrophin signaling pathway     102960590 (MAPK11)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102960590 (MAPK11)   09158 Development and regeneration    04380 Osteoclast differentiation     102960590 (MAPK11)   09159 Environmental adaptation    04714 Thermogenesis     102960590 (MAPK11)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102960590 (MAPK11)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102960590 (MAPK11)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102960590 (MAPK11)    05020 Prion disease     102960590 (MAPK11)    05022 Pathways of neurodegeneration - multiple diseases     102960590 (MAPK11)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102960590 (MAPK11)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102960590 (MAPK11)   09171 Infectious disease: bacterial    05132 Salmonella infection     102960590 (MAPK11)    05135 Yersinia infection     102960590 (MAPK11)    05133 Pertussis     102960590 (MAPK11)    05152 Tuberculosis     102960590 (MAPK11)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102960590 (MAPK11)    05161 Hepatitis B     102960590 (MAPK11)    05171 Coronavirus disease - COVID-19     102960590 (MAPK11)    05163 Human cytomegalovirus infection     102960590 (MAPK11)    05167 Kaposi sarcoma-associated herpesvirus infection     102960590 (MAPK11)    05169 Epstein-Barr virus infection     102960590 (MAPK11)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102960590 (MAPK11)    05140 Leishmaniasis     102960590 (MAPK11)    05142 Chagas disease     102960590 (MAPK11)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102960590 (MAPK11)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ptg01001]     102960590 (MAPK11) Enzymes [BR:ptg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102960590 (MAPK11) Protein kinases [BR:ptg01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102960590 (MAPK11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Cas_CT1975 Motif Other DBs NCBI-GeneID:  102960590 NCBI-ProteinID:  XP_007094103 LinkDB All DBs Position Un AA seq 186 aa AA seqDB search MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEV VGTPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFRGANPLAVDLLGRMLVLDSDQRVS AAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPPEPPQSPG SLDIEQ NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccggctatgtggccacccgctggtaccgcgcacctgagatcatgctcaactggatg cactacaaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctccag ggaaaggccctcttcccaggaaatgactacatcgaccagctgaagcgaatcatggaggtg gtgggcacgcccagccctgaggttctagcaaaaatatcatcggaacacgcccggacatac atccagtccctgccccccatgccccagaaggacctcaggagcatcttccgtggagccaac cccctggctgtggatctcctgggaaggatgctggtgctggacagtgaccagagggtcagt gcggccgaggccctggcccatgcctacttcagccagtaccacgaccccgacgatgagccc gaggctgagccctatgatgaaagcgttgaggccaaggagcggaccgtggaggagtggaag gagctcacctaccaggaggtcctcagcttcaagcccccggagccaccgcagtcacctggc agcctggatattgagcagtga

Panthera tigris altaica (Amur tiger): 102968191 Help Entry 102968191         CDS       T02988                                  Gene name MAPK13 Definition (RefSeq) mitogen-activated protein kinase 13   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01522   Endocrine resistance ptg04010   MAPK signaling pathway ptg04015   Rap1 signaling pathway ptg04068   FoxO signaling pathway ptg04071   Sphingolipid signaling pathway ptg04114   Oocyte meiosis ptg04218   Cellular senescence ptg04261   Adrenergic signaling in cardiomyocytes ptg04370   VEGF signaling pathway ptg04380   Osteoclast differentiation ptg04550   Signaling pathways regulating pluripotency of stem cells ptg04611   Platelet activation ptg04613   Neutrophil extracellular trap formation ptg04620   Toll-like receptor signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04622   RIG-I-like receptor signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04657   IL-17 signaling pathway ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04660   T cell receptor signaling pathway ptg04664   Fc epsilon RI signaling pathway ptg04668   TNF signaling pathway ptg04670   Leukocyte transendothelial migration ptg04714   Thermogenesis ptg04722   Neurotrophin signaling pathway ptg04723   Retrograde endocannabinoid signaling ptg04728   Dopaminergic synapse ptg04750   Inflammatory mediator regulation of TRP channels ptg04912   GnRH signaling pathway ptg04914   Progesterone-mediated oocyte maturation ptg04917   Prolactin signaling pathway ptg04926   Relaxin signaling pathway ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg04935   Growth hormone synthesis, secretion and action ptg05014   Amyotrophic lateral sclerosis ptg05020   Prion disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05132   Salmonella infection ptg05133   Pertussis ptg05135   Yersinia infection ptg05140   Leishmaniasis ptg05142   Chagas disease ptg05145   Toxoplasmosis ptg05152   Tuberculosis ptg05161   Hepatitis B ptg05163   Human cytomegalovirus infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05169   Epstein-Barr virus infection ptg05170   Human immunodeficiency virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05205   Proteoglycans in cancer ptg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102968191 (MAPK13)    04015 Rap1 signaling pathway     102968191 (MAPK13)    04370 VEGF signaling pathway     102968191 (MAPK13)    04668 TNF signaling pathway     102968191 (MAPK13)    04068 FoxO signaling pathway     102968191 (MAPK13)    04071 Sphingolipid signaling pathway     102968191 (MAPK13)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102968191 (MAPK13)    04218 Cellular senescence     102968191 (MAPK13)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102968191 (MAPK13)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102968191 (MAPK13)    04613 Neutrophil extracellular trap formation     102968191 (MAPK13)    04620 Toll-like receptor signaling pathway     102968191 (MAPK13)    04621 NOD-like receptor signaling pathway     102968191 (MAPK13)    04622 RIG-I-like receptor signaling pathway     102968191 (MAPK13)    04625 C-type lectin receptor signaling pathway     102968191 (MAPK13)    04660 T cell receptor signaling pathway     102968191 (MAPK13)    04658 Th1 and Th2 cell differentiation     102968191 (MAPK13)    04659 Th17 cell differentiation     102968191 (MAPK13)    04657 IL-17 signaling pathway     102968191 (MAPK13)    04664 Fc epsilon RI signaling pathway     102968191 (MAPK13)    04670 Leukocyte transendothelial migration     102968191 (MAPK13)   09152 Endocrine system    04912 GnRH signaling pathway     102968191 (MAPK13)    04914 Progesterone-mediated oocyte maturation     102968191 (MAPK13)    04917 Prolactin signaling pathway     102968191 (MAPK13)    04926 Relaxin signaling pathway     102968191 (MAPK13)    04935 Growth hormone synthesis, secretion and action     102968191 (MAPK13)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102968191 (MAPK13)   09156 Nervous system    04728 Dopaminergic synapse     102968191 (MAPK13)    04723 Retrograde endocannabinoid signaling     102968191 (MAPK13)    04722 Neurotrophin signaling pathway     102968191 (MAPK13)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102968191 (MAPK13)   09158 Development and regeneration    04380 Osteoclast differentiation     102968191 (MAPK13)   09159 Environmental adaptation    04714 Thermogenesis     102968191 (MAPK13)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102968191 (MAPK13)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102968191 (MAPK13)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102968191 (MAPK13)    05020 Prion disease     102968191 (MAPK13)    05022 Pathways of neurodegeneration - multiple diseases     102968191 (MAPK13)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102968191 (MAPK13)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102968191 (MAPK13)   09171 Infectious disease: bacterial    05132 Salmonella infection     102968191 (MAPK13)    05135 Yersinia infection     102968191 (MAPK13)    05133 Pertussis     102968191 (MAPK13)    05152 Tuberculosis     102968191 (MAPK13)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102968191 (MAPK13)    05161 Hepatitis B     102968191 (MAPK13)    05171 Coronavirus disease - COVID-19     102968191 (MAPK13)    05163 Human cytomegalovirus infection     102968191 (MAPK13)    05167 Kaposi sarcoma-associated herpesvirus infection     102968191 (MAPK13)    05169 Epstein-Barr virus infection     102968191 (MAPK13)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102968191 (MAPK13)    05140 Leishmaniasis     102968191 (MAPK13)    05142 Chagas disease     102968191 (MAPK13)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102968191 (MAPK13)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ptg01001]     102968191 (MAPK13) Enzymes [BR:ptg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102968191 (MAPK13) Protein kinases [BR:ptg01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102968191 (MAPK13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH DUF4023 Motif Other DBs NCBI-GeneID:  102968191 NCBI-ProteinID:  XP_015394372 LinkDB All DBs Position Un AA seq 523 aa AA seqDB search MASRAHSLLCPKQSTQGPRQDGDPITPVWQIVELGLPQARSQRLYAGHYSRTLGFSNGKN HQNPYSLTLMFQRRQADDKRVLSGPSPPEEEEVLGKMAQYPDGASELLPGVVSWSHPPSG TLREGRGQASNPDQSPASRNPPPIAQHKPKHYSESFPAPCYQDTPWFPWCMFLAVTSNRP GLFTPSSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELRLLKHMQHENVIGLLDVFTPA SSLRGFHDFYLVMPFMQTDLQKIMGMEFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPG NLAVNEDCELKQLFVPLSRESQILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQT VDIWSVGCIMAEMLTGKTLFKGKDYLDQLSQILKVTGVPGAEFVQKLNDKAAKSYIQSLP QSPKKDFSQLFPRASPQATDLLEKMLELDVDKRLTASQALAHPFFEPFRDPEEETEAPQP FDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRCGMKLQ NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt atggcctccagggcacacagcctcctctgcccaaagcagagcacacagggacccaggcag gatggtgaccccattaccccagtttggcagatcgtcgagctgggactgccccaggcccga agccagcgactgtatgcagggcactattctaggaccttgggattcagcaatgggaaaaat catcaaaacccctattccctaaccctgatgttccagcggaggcaggcggatgataaacga gtcctgagtgggcccagccccccagaagaggaagaggtgctggggaagatggcccagtac ccagatggggccagtgagctgctcccaggtgttgtgagctggtctcacccaccttcaggg acgctgagggaagggcgtggccaggcctctaatccagatcaaagtcctgcttcccgaaac cctccaccaatcgcccaacacaaacccaaacattatagcgagtcctttccagcaccctgc taccaagacaccccgtggttcccctggtgtatgttcctcgctgtgacgagtaacagacct ggcttgttcactcccagctccgccatcgacaagcggtcaggggagaaggtggccatcaag aagctgagccggcccttccagtcggagatctttgccaagcgggcctaccgagagctgcgc ctgctgaagcacatgcagcatgagaatgtcatcgggctcctggatgtcttcaccccagcc tcctccctgcgtggcttccatgacttctacctggtgatgcccttcatgcagacagacctg cagaagatcatggggatggagttcagtgaggacaagatccagtacctggtgtatcagatg ctcaagggtcttaagtacatccactcagctggggtcgtccacagggacctgaagccgggc aacctggccgtaaacgaggactgtgagctgaagcaactctttgttcctctgtcccgcgag tcacagatcttggattttgggctggcccggcatgcagatgctgagatgaccggctatgtg gtgacccgctggtaccgggcccctgaggtgatcctcagctggatgcactacaaccagact gtggacatctggtctgtgggctgtatcatggcagagatgctgaccgggaaaactctgttc aaggggaaagattacctggaccagctgtcccagatcctgaaagtgaccggggtgccgggt gcagagtttgtgcagaagttgaatgacaaagcagccaaatcctacatccagtccctgcca cagagccccaagaaggatttctctcagctcttcccacgggccagcccccaggccacagac ctgctagagaagatgttggagctggacgtggacaagcgtctgacggcctcgcaggccctc gcccaccccttctttgaacccttccgagacccggaggaggagacagaggccccgcagcca tttgatgactccttagaacatgagaaactcacagtggatgaatggaagcagcacatctac aaggagattgtgaacttcagccccattgcccggaaggactcacggcgccggtgtggcatg aagctgcagtga

Panthera tigris altaica (Amur tiger): 102968482 Help Entry 102968482         CDS       T02988                                  Gene name MAPK14 Definition (RefSeq) mitogen-activated protein kinase 14   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01522   Endocrine resistance ptg04010   MAPK signaling pathway ptg04015   Rap1 signaling pathway ptg04068   FoxO signaling pathway ptg04071   Sphingolipid signaling pathway ptg04114   Oocyte meiosis ptg04218   Cellular senescence ptg04261   Adrenergic signaling in cardiomyocytes ptg04370   VEGF signaling pathway ptg04380   Osteoclast differentiation ptg04550   Signaling pathways regulating pluripotency of stem cells ptg04611   Platelet activation ptg04613   Neutrophil extracellular trap formation ptg04620   Toll-like receptor signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04622   RIG-I-like receptor signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04657   IL-17 signaling pathway ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04660   T cell receptor signaling pathway ptg04664   Fc epsilon RI signaling pathway ptg04668   TNF signaling pathway ptg04670   Leukocyte transendothelial migration ptg04714   Thermogenesis ptg04722   Neurotrophin signaling pathway ptg04723   Retrograde endocannabinoid signaling ptg04728   Dopaminergic synapse ptg04750   Inflammatory mediator regulation of TRP channels ptg04912   GnRH signaling pathway ptg04914   Progesterone-mediated oocyte maturation ptg04917   Prolactin signaling pathway ptg04926   Relaxin signaling pathway ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg04935   Growth hormone synthesis, secretion and action ptg05014   Amyotrophic lateral sclerosis ptg05020   Prion disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05132   Salmonella infection ptg05133   Pertussis ptg05135   Yersinia infection ptg05140   Leishmaniasis ptg05142   Chagas disease ptg05145   Toxoplasmosis ptg05152   Tuberculosis ptg05161   Hepatitis B ptg05163   Human cytomegalovirus infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05169   Epstein-Barr virus infection ptg05170   Human immunodeficiency virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05205   Proteoglycans in cancer ptg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102968482 (MAPK14)    04015 Rap1 signaling pathway     102968482 (MAPK14)    04370 VEGF signaling pathway     102968482 (MAPK14)    04668 TNF signaling pathway     102968482 (MAPK14)    04068 FoxO signaling pathway     102968482 (MAPK14)    04071 Sphingolipid signaling pathway     102968482 (MAPK14)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102968482 (MAPK14)    04218 Cellular senescence     102968482 (MAPK14)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102968482 (MAPK14)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102968482 (MAPK14)    04613 Neutrophil extracellular trap formation     102968482 (MAPK14)    04620 Toll-like receptor signaling pathway     102968482 (MAPK14)    04621 NOD-like receptor signaling pathway     102968482 (MAPK14)    04622 RIG-I-like receptor signaling pathway     102968482 (MAPK14)    04625 C-type lectin receptor signaling pathway     102968482 (MAPK14)    04660 T cell receptor signaling pathway     102968482 (MAPK14)    04658 Th1 and Th2 cell differentiation     102968482 (MAPK14)    04659 Th17 cell differentiation     102968482 (MAPK14)    04657 IL-17 signaling pathway     102968482 (MAPK14)    04664 Fc epsilon RI signaling pathway     102968482 (MAPK14)    04670 Leukocyte transendothelial migration     102968482 (MAPK14)   09152 Endocrine system    04912 GnRH signaling pathway     102968482 (MAPK14)    04914 Progesterone-mediated oocyte maturation     102968482 (MAPK14)    04917 Prolactin signaling pathway     102968482 (MAPK14)    04926 Relaxin signaling pathway     102968482 (MAPK14)    04935 Growth hormone synthesis, secretion and action     102968482 (MAPK14)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102968482 (MAPK14)   09156 Nervous system    04728 Dopaminergic synapse     102968482 (MAPK14)    04723 Retrograde endocannabinoid signaling     102968482 (MAPK14)    04722 Neurotrophin signaling pathway     102968482 (MAPK14)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102968482 (MAPK14)   09158 Development and regeneration    04380 Osteoclast differentiation     102968482 (MAPK14)   09159 Environmental adaptation    04714 Thermogenesis     102968482 (MAPK14)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102968482 (MAPK14)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102968482 (MAPK14)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102968482 (MAPK14)    05020 Prion disease     102968482 (MAPK14)    05022 Pathways of neurodegeneration - multiple diseases     102968482 (MAPK14)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102968482 (MAPK14)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102968482 (MAPK14)   09171 Infectious disease: bacterial    05132 Salmonella infection     102968482 (MAPK14)    05135 Yersinia infection     102968482 (MAPK14)    05133 Pertussis     102968482 (MAPK14)    05152 Tuberculosis     102968482 (MAPK14)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102968482 (MAPK14)    05161 Hepatitis B     102968482 (MAPK14)    05171 Coronavirus disease - COVID-19     102968482 (MAPK14)    05163 Human cytomegalovirus infection     102968482 (MAPK14)    05167 Kaposi sarcoma-associated herpesvirus infection     102968482 (MAPK14)    05169 Epstein-Barr virus infection     102968482 (MAPK14)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102968482 (MAPK14)    05140 Leishmaniasis     102968482 (MAPK14)    05142 Chagas disease     102968482 (MAPK14)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102968482 (MAPK14)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ptg01001]     102968482 (MAPK14) Enzymes [BR:ptg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102968482 (MAPK14) Protein kinases [BR:ptg01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102968482 (MAPK14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like Motif Other DBs NCBI-GeneID:  102968482 NCBI-ProteinID:  XP_015394374 LinkDB All DBs Position Un AA seq 343 aa AA seqDB search WEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKH MKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRG LKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNW MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGADLLKKISSESARN YIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE PVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt tgggaggtgccggagcgttaccagaacctgtccccggtgggctccggtgcctatggctcc gtgtgtgctgcctttgacacaaaaactgggttacgtgtggcagtgaagaagctctccaga ccgtttcagtccatcattcatgccaaaaggacctacagagaactgcggttacttaaacat atgaaacatgaaaatgtgattggtctgttggatgtttttacacctgcaaggtctctggag gaattcaatgatgtgtatctggtgacccatctcatgggagcagatctgaacaacattgtg aaatgtcagaagcttacggatgaccatgttcagttccttatctaccagattctccgaggt ctcaagtatatacattcagctgacataattcacagggacctgaagcctagtaatctagct gtgaatgaagactgtgagctgaagatcttggattttggactggctcgacatacagatgat gaaatgacaggctatgtggccactaggtggtacagggctcctgagatcatgctgaactgg atgcattacaaccagacagttgatatttggtcagtgggatgcataatggccgagctgttg actggaagaacgttgtttcctggtacagaccatattgatcagttgaagctcattttaaga ctcgttggaaccccaggggctgatcttttgaagaaaatctcctcagagtctgcaagaaac tacattcagtctttgacccagatgccgaaaatgaactttgcaaatgtatttattggtgcc aatcccttggcggtggacttgctggagaagatgcttgtactggactcagacaagagaatc acagcggcccaagcacttgcacacgcctactttgcccagtaccatgatcctgatgatgaa ccagtggccgatccttatgatcagtcctttgaaagcagggacctccttatagatgaatgg aagagcctgacctacgatgaagtcatcagctttgtgcccccaccccttgaccaagaagag atggaatcctga

DBGET integrated database retrieval system