KEGG   Panthera tigris altaica (Amur tiger): 102960317
Entry
102960317         CDS       T02988                                 

Gene name
MAP3K5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04010  MAPK signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04141  Protein processing in endoplasmic reticulum
ptg04210  Apoptosis
ptg04530  Tight junction
ptg04668  TNF signaling pathway
ptg04714  Thermogenesis
ptg04722  Neurotrophin signaling pathway
ptg04932  Non-alcoholic fatty liver disease
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102960317 (MAP3K5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102960317 (MAP3K5)
   04668 TNF signaling pathway
    102960317 (MAP3K5)
   04071 Sphingolipid signaling pathway
    102960317 (MAP3K5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102960317 (MAP3K5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102960317 (MAP3K5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102960317 (MAP3K5)
  09159 Environmental adaptation
   04714 Thermogenesis
    102960317 (MAP3K5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102960317 (MAP3K5)
   05012 Parkinson disease
    102960317 (MAP3K5)
   05014 Amyotrophic lateral sclerosis
    102960317 (MAP3K5)
   05016 Huntington disease
    102960317 (MAP3K5)
   05017 Spinocerebellar ataxia
    102960317 (MAP3K5)
   05022 Pathways of neurodegeneration - multiple diseases
    102960317 (MAP3K5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102960317 (MAP3K5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102960317 (MAP3K5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102960317 (MAP3K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102960317 (MAP3K5)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102960317 (MAP3K5)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: STE group
  STE11 family
   102960317 (MAP3K5)
SSDB
Motif
Pfam: DUF4071 Pkinase PK_Tyr_Ser-Thr ASK_PH FPP Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 102960317
NCBI-ProteinID: XP_007096464
LinkDB
Position
Un
AA seq 1336 aa
MPATSAAPRSGILVHFRPRLRDASRNPPVLRNAGLPALYQTARRASPAGGRRTTVAYVIN
EASQGQLVMAESEALQSLREACETVGATLETVHFGKLDFGETAVLDRFYNADIAVVEMSD
AFRQPSLFYHLGVRESFSMANNIILYCDNNSDSLQSLKEIICQKNTMCTGNYTFVPYMIT
PHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILN
DIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLE
KLPTFDLASHHHVKFHYAFALNRRNLPGDRAKALDIMIPLVQSEGQVASDMYCLVGRIYK
DMFLDSNFLDTESRDYGASWFKKAFESEPSLQSGINYAVLLLAAGHQFESSFELRKVGVK
LSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETI
LIYKHFVKLTTEQPVAKQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSIN
NEVEEKTISIWHVLPDDKKGIHEWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFC
TELHCKKFFEMVNTITEEKGRSTEEGDCEGDSLEYDYEYDENGDRVVLGKGTYGIVYAGR
DLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVP
GGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVL
KISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGK
PPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFL
KVSSKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSF
KTRAKSCGQRDVKGIRTLFXSIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRIL
TEDQDKVVRNLMESLAQGTEEPKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELD
FDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHF
SLASESDTADQEDLDAEDEREEQPSNQTVQRPHAVIEDAVATSGVSTLSSTVSHDSQNAH
RSLNVQLGRMKIETNRLLEELVQKEKELQALLHQAIEEKDHEIKHLKLKSQPIDIPGVPV
CHRDSLGTNAEESELAEWLREKGADEDTISRFLAEDYSLEDVLYYVTRDDLKCLRLRGGI
LCMLWKAITDFRDKQT
NT seq 4011 nt   +upstreamnt  +downstreamnt
atgccggccacttccgcagcgccacggtcaggaatcctcgtccactttaggccccggctg
cgggacgctagtcgaaatcctccagtcttgcgcaacgcgggcctccccgcgctgtaccag
accgcgcgcagagctagcccggcaggcggccgacggaccacggtggcgtatgtgatcaac
gaagcgagccaggggcagctggtgatggccgagagcgaggccctgcagagcctgcgggag
gcgtgcgagacggtgggcgccaccctggagaccgtgcattttggtaaactggactttggg
gaaaccgcggtgctggatcgtttctacaatgcagatatcgctgtggtggagatgagtgac
gccttccgacagccatcgttgttttaccacctcggggtcagagaaagtttcagcatggcc
aacaacatcatcctctactgtgataataattcagactctctgcagtcactgaaggaaatc
atttgccagaagaatactatgtgcactgggaactacacattcgttccttacatgatcact
ccgcataataaagtctactgctgcgatagcagcttcatgaaggggttgacagagctcatg
caaccgaacttcgagctgcttcttggacccatttgcttacctcttgtggaccgtttcatt
caacttctgaaggtggcacaagcaagttccagccagtatttccgggaatctatactcaat
gatatcaggaaagctcgtaatttatacactggtaaagaattggcagctgaattggcaaga
attcggcagcgagtagataatattgaagtcttgacagcagatattgtcataaacctgtta
ctttcctacagagatatccaggactatgattctattgtgaagctggtagagacgttagaa
aagctgccaacctttgatttggcttcccatcaccatgtgaagtttcattatgcatttgca
ctgaataggagaaatctccctggagacagagcaaaagctcttgatattatgattcccctg
gtgcaaagtgaagggcaagttgcttcagatatgtattgcctagtgggccgaatctacaaa
gatatgtttttggactctaatttcctggacactgaaagtagagactatggagcttcttgg
ttcaaaaaggcatttgaatctgagccatcactacagtcaggaattaattatgcggtcctt
ctcctggcagctgggcaccagtttgaatcttcctttgagctccggaaagttggggtgaag
ctaagtagccttcttggtaaaaagggaaacttagaaaaactccagagctactgggaagtt
ggattttttctgggtgccagtgtcctggccaatgaccacatgagagtcatccaagcatct
gaaaagctttttaaactgaagacgccagcatggtacctcaagtctattgtagagacaatt
ttgatatataagcattttgtgaaactgactacagagcagcctgtggccaaacaggagctg
gtggacttctggatggatttcctggtggaggccacaaagacagatgttactgtagttagg
tttccggtgttaatattagaaccaactaaaatctatcagccttcatatttgtctatcaac
aatgaagttgaggagaagacaatatctatttggcatgtgcttcctgatgacaagaaaggt
atacatgagtggaattttagtgcttcttctgtcaggggagtgagtatttctaaatttgaa
gaacgatgctgttttctttatgtgcttcataattctgacgatttccaaatctatttctgt
acagaacttcattgtaaaaagttttttgaaatggtgaacaccattactgaagagaagggg
agaagcacagaggaaggtgattgtgaaggtgactccttggagtatgactacgaatatgat
gagaacggagacagagttgttttaggaaagggcacttacgggattgtctacgcaggccga
gacctgagcaaccaagtcagaattgctataaaggaaatcccagaaagagatagcagatac
tcccagcccctacatgaagaaatagcattgcataagcatctgaagcataaaaatattgtc
cagtatctgggctctttcagtgagaatggtttcatcaaaatcttcatggagcaggtccca
ggaggaagtctttcagctctccttcgttccaaatggggcccattgaaggacaatgagcaa
acaattggcttctatacaaagcaaatacttgaaggattaaaatacctccatgacaatcag
atagtccaccgggatataaagggtgacaatgtgttgattaatacctacagtggcgttctc
aagatctcagacttcgggacatcaaagaggcttgctggcattaacccgtgtactgaaact
tttactggtacccttcagtatatggcaccagaaatcatagacaaaggaccaagaggctac
gggaaagcagcagacatttggtctttgggctgcacgatcatcgaaatggccacagggaaa
ccacctttttatgaactgggagaaccacaagcagctatgttcaaggtgggaatgtttaaa
gtccacccggagatcccagagtccatgtccgcagaggccaaggcgttcatattgaaatgt
tttgaaccggaccccgacaagagagcctgtgctaatgacttgcttattgacgagttctta
aaagtttcaagcaaaaagaagaagacgcaacctaagctttcagccctctcagctggatca
aatgagtatcttagaagcatatccttgcctgtgcccgtcttggtggaggacaccagcagc
agcagcgaatacggctcggtttctccggacacggagttgaaggtggatcccttctctttc
aagacgagagccaaatcctgtggacagcgagacgtaaaaggaatacggacactctttnac
agcattccagacgaaaatttcgaagaccacagcgctccaccttcccctgaagagaaagat
tctggattctttatgctgaggaaggacagtgagagacgggccactcttcacaggatcctg
accgaagaccaagacaaagttgtgaggaacttaatggaatctttggctcaggggactgaa
gaacctaaactaaaatgggaacacatcacaaccctcattgcaagcctcagagaatttgtg
agatccacggaccgaaaaatcatagccaccacactgtctaagctgaagctagaacttgac
tttgacagccatggcatcagtcaagttcaggtggtactcttcggttttcaagatgccgtc
aataaagttcttcggaatcataacatcaagccacactggatgtttgccttagacagtatc
atccgaaaggcagtgcagacggccatcaccattctggtgccagaactgaggccacatttc
agcctcgcatctgagagtgataccgcggatcaagaagacttggatgcggaagatgagcgt
gaggaacagccttcaaaccaaactgtccaaagacctcatgctgtcattgaagatgccgtg
gctacctcaggggtgagcacgctcagttctactgtatcccatgactcccaaaatgctcac
cgatcactcaatgtgcagcttggaaggatgaaaatagaaactaatagattactggaagaa
ttggttcagaaagagaaagaattacaagcactccttcatcaagctattgaagaaaaagac
cacgaaattaaacacctgaagcttaagtcccaaccaatagatattcctggagtgcctgtg
tgtcaccgggattctctgggcacaaatgctgaagagtctgaacttgctgaatggctgaga
gaaaagggagctgatgaagacactataagtcggtttctggctgaggattattcactagag
gatgttctctactatgttacacgtgatgatttaaaatgcctgagactaaggggaggaata
ctctgcatgctgtggaaggccatcactgactttcgagacaaacagacttga

DBGET integrated database retrieval system