KEGG   Panthera tigris altaica (Amur tiger): 102960424
Entry
102960424         CDS       T02988                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg03320  PPAR signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04210  Apoptosis
ptg04510  Focal adhesion
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04910  Insulin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04931  Insulin resistance
ptg04960  Aldosterone-regulated sodium reabsorption
ptg05145  Toxoplasmosis
ptg05205  Proteoglycans in cancer
ptg05213  Endometrial cancer
ptg05215  Prostate cancer
ptg05223  Non-small cell lung cancer
ptg05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102960424 (PDPK1)
   04071 Sphingolipid signaling pathway
    102960424 (PDPK1)
   04151 PI3K-Akt signaling pathway
    102960424 (PDPK1)
   04152 AMPK signaling pathway
    102960424 (PDPK1)
   04150 mTOR signaling pathway
    102960424 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102960424 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    102960424 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102960424 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102960424 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    102960424 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102960424 (PDPK1)
   03320 PPAR signaling pathway
    102960424 (PDPK1)
   04919 Thyroid hormone signaling pathway
    102960424 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102960424 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102960424 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102960424 (PDPK1)
   05231 Choline metabolism in cancer
    102960424 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102960424 (PDPK1)
   05213 Endometrial cancer
    102960424 (PDPK1)
   05223 Non-small cell lung cancer
    102960424 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102960424 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102960424 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102960424 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102960424 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102960424 (PDPK1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102960424 (PDPK1)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   102960424 (PDPK1)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    102960424 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 102960424
NCBI-ProteinID: XP_007098785
LinkDB
Position
Un
AA seq 531 aa
MMYDTVPIQSSVVLCSCPSPSMVRTQTESGSAPGIPSGGSRQGSTMDSTAAESRSSANSL
QHTTQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKV
PYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRF
YTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVG
TAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEK
FFPKARDLVEKLLVLDATKRLGCEEMGGYGPLQAHPFFESISWENLQHQTPPKLTAYLPA
MSEDDEDCYGNPPAGAGPLPPAAGSNIEQYIHDLDTNSFELDLQFSQDEKRLLLEKQASG
NPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELR
PEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWRHRYQSHPDAAVQ
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgatgtatgacaccgttcctattcagtccagcgtggtgttatgttcttgcccgtcccca
tcaatggtgaggacccagactgagtccggctcggcccctggcattcccagtggtggtagc
agacagggctccaccatggacagcaccgcggctgagtcccgatcgagcgccaactcgctg
cagcacaccacacagccaccgccacagcctcggaagaaacggcccgaagacttcaaattt
gggaaaattcttggtgaaggctctttctcaacagttgtcctggcccgagaactggcaacc
tcaagggaatacgctattaaaattctagagaaacgtcacattatcaaagagaacaaggtc
ccgtatgtaaccagagagagagacgtgatgtcacgcctggatcacccgttctttgttaaa
ctttacttcacatttcaggatgatgaaaagctgtactttggtcttagttatgccaaaaat
ggagaactacttaaatacattcgcaaaattggctcattcgatgagacgtgcacccggttt
tacacggccgagatggtgtcggctctggagtacttgcatggcaagggcatcattcacagg
gacctgaaaccggaaaacattttgttaaatgaagacatgcacatccagatcacagatttt
ggaaccgcgaaagtcttatccccggagagtaaacaagccagggccaactcgtttgtagga
acagcccagtatgtgtctccagagctgctcacagagaaatcggcctgtaaaagttcggac
ctttgggctctcggatgtataatatatcagcttgtggcaggactgccgccttttcgagcg
ggaaatgaatatcttatatttcagaagatcattaagctggagtatgactttcctgaaaaa
ttcttccctaaggcaagagaccttgtggaaaaacttttggttttagatgccacgaagcga
ttaggctgcgaggaaatgggagggtacggccctctgcaggctcaccccttcttcgagtcc
atctcgtgggagaacctgcagcatcagacgcctccgaagctcaccgcttacctgccggcc
atgtcggaagatgacgaggactgctacgggaacccccccgccggggccgggcccctcccg
ccagcggcgggcagcaacatcgagcagtacatccatgacctggacactaactcttttgag
ctggacctccagttttcccaagacgagaagaggctcctgctggagaagcaggccagcggc
aatccttggcaccagtttgtagaaaataacttgatactaaagatgggtccggtagataag
cgaaagggcttgtttgcacgacgacgacagctactgctcacagaagggccacacttgtat
tatgtggatcctgttaacaaagtcctgaagggcgaaattccgtggtcacaagaactccga
ccagaggccaagaactttaaaaccttctttgtccacacgccgaacaggacgtattacctg
atggacccgagtgggaatgctcacaaatggtgcaaaaagatccaggaagtgtggagacac
aggtaccagagccacccggacgccgccgtgcagtga

DBGET integrated database retrieval system