KEGG   Panthera tigris altaica (Amur tiger): 102960521Help
Entry
102960521         CDS       T02988                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00052  Galactose metabolism
ptg00500  Starch and sucrose metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102960521 (GANC)
   00500 Starch and sucrose metabolism
    102960521 (GANC)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102960521 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 102960521
NCBI-ProteinID: XP_007081759
LinkDB All DBs
Position
Un
AA seq 808 aa AA seqDB search
MEAAGKEEISVEDEAVDKNIFKDCSKIAFYRRQKQQLSTKSTYQALLDSATKGKDSTKFQ
ILNEATKVPLLAEVYGIEGNIFRVKINEETPLKPRYEVPDVVTSKPRTVRLISSSGDAGS
LVLADGKGDLKCHITANPFKVDLVSEEEVVMSINSLGHLYFEHLQVPLKKRATKENKEDT
SVDASQENQEDLGLWEEKFGKFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKPGRTLGIFWLNASETLVEINTEPAV
KYTLTQMGPVAAKQKVRSQTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRNKKRKLVVISDPHIKIDPDYSVYAEAKEQGFFVRNHEGGDFAGVCWPGLSSYLD
FTNPKVREWYSSLFTFSAYQGSTDILYIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSVTGIPFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRQRYTLLPYWYSLFYRAHVAAEPVMRPLWIEFPEELNTFGVEDEYMLGSA
LLVHPVTEPKATTVSVFLPGSNEVWYDSKTGTHWEGACTVKIPVTLDTIPVFQRGGSIVP
IKTTIGKSTGYMTDSPYGLRVALSTKLC
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgctgggaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagcagctctccacaaag
tccacctatcaggcattactagactccgccacaaaaggcaaagacagcaccaagttccaa
atcctcaatgaagcaactaaggttcctcttctggctgaagtttatggtatagagggaaat
attttcagggttaaaatcaatgaagaaactcccctgaaaccgaggtatgaagttcctgat
gttgtcacaagcaagccacgcaccgtaaggctgatttcatcctcaggagatgcaggtagt
ctggtattggctgatggaaaaggagatctgaagtgtcatatcacagcaaacccattcaag
gtagatttagtgtctgaagaagaggttgtgatgagcataaactccctgggccacttgtac
tttgagcacctgcaagttcctctcaagaaaagagctaccaaagaaaataaggaggacaca
tcagttgacgcttctcaggaaaaccaagaggatctaggcttgtgggaggagaaattcgga
aaatttgtggatgtcaaagttaatggccctgcttccattggtttggatttctccttgcac
ggatttgagcatctttacgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgatggcgatgcttaccgtctttataatctggatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaaccaggcaggactcta
ggcattttttggctgaatgcctcagaaacgctagtggagatcaatacagagcctgcagta
aagtacacactgacccagatgggccccgttgcagctaaacaaaaggtcagatctcaaact
gatgtgcattggatgtcagagagtggaatcattgatgtttttctgctgacaggacctaca
ccttctgatgttttcaagcagtactcataccttacaggcacacaagccatgccccctctc
ttctctctggggtaccatcagtgccgctggaactatgaggatgagcaggatgtaaaagca
gtggatgcaggatttgatgagcatgacattccttatgatgtcatgtggctggacatagag
cataccgagggcaaaaggtacttcacctgggacaagaaaagattcccaaatcccaaaagg
atgcaagagctgctcagaaacaaaaaacgtaagcttgtggtcatcagtgacccccacatc
aagattgatcctgactactcagtgtatgctgaggccaaagaacagggcttctttgtgagg
aatcacgaaggaggagactttgcaggggtatgctggcctggtctctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcaagtcttttcactttctctgcctatcag
ggatctactgacatcctctacatatggaacgacatgaatgagccctctgtctttagagga
ccagagctaaccatgcagaagaatgccattcatcatggcaattgggagcacagggaactt
cacaacatctatggtttttatcagcaaatggctactgcagaaggactgatacagcgatct
aaaggaaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgctgtgtggacaggcgacaacacggcagaatggagctacctgaaaatttctatccct
atgttactcaccctcagcgttactgggatccctttttgtggagctgacgtaggtggcttc
attgggaatccagaagcagagctgctagtgcgttggtaccaggccggagcctaccagccc
ttcttccggggccacgctaccatgaacaccaagcggcgggagccatggctctttggggag
gaacacacccggctcatccgagaagccatcagacagcgctacaccctcctgccctattgg
tattctctgttctaccgggcacacgtggctgccgaacccgtcatgaggcctctatggata
gagttcccagaggaattaaacactttcggtgtggaagatgaatacatgctaggaagtgct
ttattggttcatccagtcacagaaccaaaagccaccacagtcagtgtgtttctgccagga
tcaaatgaggtctggtatgactctaaaacaggtactcattgggaaggagcatgtactgtg
aagatcccagtaactttggacactataccagtgtttcaacgaggtggaagtatagtgccc
ataaagacaactataggaaaatccacaggctacatgactgattccccatatggactccgg
gtggctctcagcactaagttgtgctga

DBGET integrated database retrieval system